BYKdb

Annotate results for A0A062L0G0

A0A062L0G0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A062L0G0
DOMAINtad9/264DTIDLKELFFSLIAQWKLIVLCILISLVCALIYLRVTPNTYSVDALVQVEDTKSAASAAL
LGELSKMVDQKSPAEAEIQVLTSRMVLGQVIHNLNLDITIKNHDDTFFNRLLSQDKQNID
YKKDAVTFSNKDSYFSIQQFQIPSYYLDKPLLLSFKDQGHFTFSYKDKVIFSGQLNSNNL
VTAREGQWKVRINSTHAPSVEQQFTISKLALPTAVQKLGSTYGVAERGKQTGVIGLSFQG
TDKEHITEVLNNILAV
DOMAINcd540/727AGPSPEVGKSFISTNLATIFAQGNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQAD
LQKVLHKTQVTNLDVITRGKSPTNPSEMLSSTQFKDLLEKFQSQYDHIIIDTPPVLAVTD
GIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNY
AYAYKAQK
SITEWalker A547/549GKS
SITEWalker A'567/574LLIDADMR
SITEWalker B647/653IIIDTPP
SITE-577/-581YMHKY
SITE-618/-620GKS
SITEY Cluster713/723YGYGYNYAYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSQTSKTEDTIDLKELFFSLIAQWKLIVLCILISLVCALIYLRVTPNTYSVDALVQVEDTKSAASAALLGELSKMVDQKS
        DTIDLKELFFSLIAQWKLIVLCILISLVCALIYLRVTPNTYSVDALVQVEDTKSAASAALLGELSKMVDQKS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PAEAEIQVLTSRMVLGQVIHNLNLDITIKNHDDTFFNRLLSQDKQNIDYKKDAVTFSNKDSYFSIQQFQIPSYYLDKPLL
PAEAEIQVLTSRMVLGQVIHNLNLDITIKNHDDTFFNRLLSQDKQNIDYKKDAVTFSNKDSYFSIQQFQIPSYYLDKPLL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSFKDQGHFTFSYKDKVIFSGQLNSNNLVTAREGQWKVRINSTHAPSVEQQFTISKLALPTAVQKLGSTYGVAERGKQTG
LSFKDQGHFTFSYKDKVIFSGQLNSNNLVTAREGQWKVRINSTHAPSVEQQFTISKLALPTAVQKLGSTYGVAERGKQTG

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VIGLSFQGTDKEHITEVLNNILAVYHSQNIERRTLESKQTLDFLDKQLPDLKQQLEESERKFNQFREKYNTVDVTQEAEL
VIGLSFQGTDKEHITEVLNNILAV                                                        

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YLKQNIALETTKTELKQKQAELAAKYTNDHPLMAEINAQLAAVNKKSAELSDTLKRLPEVQRQYLQLYRDVKVNTELYTS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLNSYQQLKIAKAGEIGNVRIIDTAVEPIKPIKPRPLLVLFLSLVVGGFIGTVLALLRNMLRTGVKDSTQIENDLNLPVY


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATVPRSPIQETRMNILKKKKSIPILAVKSSDDIAIESLRSIRTAIHFALTTAKNNIIMIAGPSPEVGKSFISTNLATIFA
                                                           AGPSPEVGKSFISTNLATIFA
                                                                  GKS           
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QGNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVTNLDVITRGKSPTNPSEMLSSTQFKDLLEKF
QGNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVTNLDVITRGKSPTNPSEMLSSTQFKDLLEKF
      LLIDADMR                                                                  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYA
QSQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYA
      IIIDTPP                                                           YGYGYNYA
         
....:....
YAYKAQKED
YAYKAQK  
YAY      

© 1998-2019