BYKdb

Annotate results for A0A062ME93

A0A062ME93 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A062ME93
DOMAINcd213/398AGPSPEVGKSFISTNLATIFAQGNKRVLLIDADMRRGYMHKYFDIDVKPGLSELLSGQTD
LQQVLHKTQVANLDVITRGKSPTNPSEMLSSPQFKELLEQLQTQYDHIIIDTPPVLAVTD
GIIISQYTGVNLIVARYIKSHMKELELTVNRFEQAGVKVNGFILNDIQRSSGGYGYNYAY
AYKAQK
SITEWalker A220/222GKS
SITEWalker A'240/247LLIDADMR
SITEWalker B320/326IIIDTPP
SITE-250/-254YMHKY
SITE-291/-293GKS
SITEY Cluster386/394YGYNYAYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEKLKIELQQKQAELSAKYTNDHPLIRQIDAQIAEINKKIADLNNRLTQLPETQRLYLQLYRDVKVNTELYTSLLNSYQQ


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LKIANAGEIGNVRIIDTAVEPVKPIKPNKLIILALSILAGGFIGVLIALLRNMMRSGVKDSTQIETELDLPVYATVPRSP


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IQETRMSILKKKKSIPILAVKSSDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTNLATIFAQGNKRVL
                                                    AGPSPEVGKSFISTNLATIFAQGNKRVL
                                                           GKS                 L
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIDADMRRGYMHKYFDIDVKPGLSELLSGQTDLQQVLHKTQVANLDVITRGKSPTNPSEMLSSPQFKELLEQLQTQYDHI
LIDADMRRGYMHKYFDIDVKPGLSELLSGQTDLQQVLHKTQVANLDVITRGKSPTNPSEMLSSPQFKELLEQLQTQYDHI
LIDADMR                                                                        I
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IIDTPPVLAVTDGIIISQYTGVNLIVARYIKSHMKELELTVNRFEQAGVKVNGFILNDIQRSSGGYGYNYAYAYKAQKED
IIDTPPVLAVTDGIIISQYTGVNLIVARYIKSHMKELELTVNRFEQAGVKVNGFILNDIQRSSGGYGYNYAYAYKAQK  
IIDTPP                                                           YGYNYAYAY      
© 1998-2019