BYKdb

Annotate results for A0A062UCS5

A0A062UCS5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A062UCS5
DOMAINtad24/214MPTDLKSLLGTVYRRFWLIAISFLTVFMLVAYVTFTATPTYRSTAVVQLDTEQQNVIDLG
SVLSGLVASTAVIDTEVMVMQSKSLLTKVAEKQKLDEDAEFNWTLREEKPGMFDGLKRQI
KSLFGMSTAKKDPFAGMSVDERNAAIEDAVVGTLMSKVSVGRVGTTYLISVTVTSESPET
AARLANAVADQ
DOMAINcd561/751TSSLPDEGKTSLTLALGRMSAMSGARTLVIDGDFRRRQLTDAAGLKPEIGFIEYLFGAGQ
LSDAITKDPKSMLDILPLSLTGHTPHDVFGTRAFDDLLVRLRSMYDLILIDTGPLLLMAE
ARVVSGKTDKAILVVRWRHTNRSAARQSLGLLKSFKADLLGVTLNMVNLNRRRHYRDPGA
GYDAYRKYYQI
SITE-686/-688GKT
SITEWalker A'588/595LVIDGDFR
SITEWalker B668/674ILIDTGP
SITEY Cluster742/749YDAYRKYY
SITEWalker A568/570GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSKTFSFELPSQVPAEAETTGNAMPTDLKSLLGTVYRRFWLIAISFLTVFMLVAYVTFTATPTYRSTAVVQLDTEQQNVI
                       MPTDLKSLLGTVYRRFWLIAISFLTVFMLVAYVTFTATPTYRSTAVVQLDTEQQNVI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLGSVLSGLVASTAVIDTEVMVMQSKSLLTKVAEKQKLDEDAEFNWTLREEKPGMFDGLKRQIKSLFGMSTAKKDPFAGM
DLGSVLSGLVASTAVIDTEVMVMQSKSLLTKVAEKQKLDEDAEFNWTLREEKPGMFDGLKRQIKSLFGMSTAKKDPFAGM

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVDERNAAIEDAVVGTLMSKVSVGRVGTTYLISVTVTSESPETAARLANAVADQYRVQQMETKLDATRRATEWLTDRTSA
SVDERNAAIEDAVVGTLMSKVSVGRVGTTYLISVTVTSESPETAARLANAVADQ                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LKSEVEDKENRVAKFIADNDMETAMGGTITEQNISYLTTQKTQAEVELNRARSRYDSLQRQIASGAGVDGISEVLESQLI


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TNLKQQLSSVRSRVEDLKTRLGPQHPELIGAMAEQDDIERQIQAEMQRIANNLENEVKVKRDQVNRLQGQINQAGSKLRG


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NNLANVRLRELQRDAETSRILYEEFISRSKETREQSDLIEPDAIILSNASVPHSPSAPRTKLNLLIGAVLGGILGAGLAL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAEMFDMKISSSEDIEKKLGVNAIGTVPLIKTSNALGFGQMNPADYLIENPLSAFAESVRYLRAAIAFSDLDSETKTVAI


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSSLPDEGKTSLTLALGRMSAMSGARTLVIDGDFRRRQLTDAAGLKPEIGFIEYLFGAGQLSDAITKDPKSMLDILPLSL
TSSLPDEGKTSLTLALGRMSAMSGARTLVIDGDFRRRQLTDAAGLKPEIGFIEYLFGAGQLSDAITKDPKSMLDILPLSL
       GKT                 LVIDGDFR                                             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGHTPHDVFGTRAFDDLLVRLRSMYDLILIDTGPLLLMAEARVVSGKTDKAILVVRWRHTNRSAARQSLGLLKSFKADLL
TGHTPHDVFGTRAFDDLLVRLRSMYDLILIDTGPLLLMAEARVVSGKTDKAILVVRWRHTNRSAARQSLGLLKSFKADLL
                           ILIDTGP                                              
       730       740       750       760       770       780       790        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
GVTLNMVNLNRRRHYRDPGAGYDAYRKYYQIETKPSLFGFKWKSAGKKDDGSVRPKAIQTPPSLAEHSSEPPEKVDAE
GVTLNMVNLNRRRHYRDPGAGYDAYRKYYQI                                               
                     YDAYRKYY                                                 

© 1998-2019