BYKdb

Annotate results for A0A062UIT5

A0A062UIT5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A062UIT5
DOMAINtad11/201MPIDFKALIGTVYRRFWIIVTGFLVTLFAVAYITFTQTPIYKANSILQLDTNKENVIDLG
SVLGGLAASTATIDTEVRVMGSKSLLTKVATKLKLSEDPEFNWTLREQKPSLIDMAKGQI
GAWTGHPPKKTVPYANLSAAEREAAILESVTRTLMNKVHISRIGTTYLIQVEVTSQSPET
AARIADAVADQ
DOMAINcd548/738TSSLPDEGKTSLTLSLGRMSAMSGSRTLVIDGDFRRRQLTDAAGMSPEIGFIEHLFGAGQ
LSDAICKDSRSMLDILPLSKAGHVPHDVFGTRAFDDLLARLRSMYDLILIDTGPLLLMAE
ARVVAGKTDKTILVIRWRRSLRSAVRQSLTLLKTFNADLLGITLNMVDLTRRRHHKDPGA
AYKAYSKYYSM
SITE-673/-675GKT
SITEWalker A'575/582LVIDGDFR
SITEWalker B655/661ILIDTGP
SITEY Cluster729/736YKAYSKYY
SITEWalker A555/557GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPLGGGSSDDMPIDFKALIGTVYRRFWIIVTGFLVTLFAVAYITFTQTPIYKANSILQLDTNKENVIDLGSVLGGLAAST
          MPIDFKALIGTVYRRFWIIVTGFLVTLFAVAYITFTQTPIYKANSILQLDTNKENVIDLGSVLGGLAAST

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATIDTEVRVMGSKSLLTKVATKLKLSEDPEFNWTLREQKPSLIDMAKGQIGAWTGHPPKKTVPYANLSAAEREAAILESV
ATIDTEVRVMGSKSLLTKVATKLKLSEDPEFNWTLREQKPSLIDMAKGQIGAWTGHPPKKTVPYANLSAAEREAAILESV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TRTLMNKVHISRIGTTYLIQVEVTSQSPETAARIADAVADQYRVQQLDSKLEATRRATAWLSERVAGLRDEVEAKEKRVE
TRTLMNKVHISRIGTTYLIQVEVTSQSPETAARIADAVADQ                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EFRAETGLLSAQGATLTEQQIAYNTTQKSQLQAQLNRARSRYDNMKRQIDSGVGIDAIAEVLDSPVISGLKAQRAQILRR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAELETTLGPSHPELIGARNEAADIEKQIEAEVNRIAANLENEVKAAQDQINSINSNIGQSTAQLRGNNINLVRLRELER


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAETSRVLYEEFISRSKETREQDDLVQADANILSTATVPDSPSSPKKLLNLIIGALLGGIIGGGLALLAEIFDMKISSAD


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DIERKLGVNSIGSVPLIRSTSLLPFSQINPADFLVDNPLSAFAESIRYLRAAIAFSDLDSETKTVAITSSLPDEGKTSLT
                                                                   TSSLPDEGKTSLT
                                                                          GKT   
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSLGRMSAMSGSRTLVIDGDFRRRQLTDAAGMSPEIGFIEHLFGAGQLSDAICKDSRSMLDILPLSKAGHVPHDVFGTRA
LSLGRMSAMSGSRTLVIDGDFRRRQLTDAAGMSPEIGFIEHLFGAGQLSDAICKDSRSMLDILPLSKAGHVPHDVFGTRA
              LVIDGDFR                                                          
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FDDLLARLRSMYDLILIDTGPLLLMAEARVVAGKTDKTILVIRWRRSLRSAVRQSLTLLKTFNADLLGITLNMVDLTRRR
FDDLLARLRSMYDLILIDTGPLLLMAEARVVAGKTDKTILVIRWRRSLRSAVRQSLTLLKTFNADLLGITLNMVDLTRRR
              ILIDTGP                                                           
       730       740       750       760       770       780     
....:....|....:....|....:....|....:....|....:....|....:....|....:
HHKDPGAAYKAYSKYYSMETKRSIFGWNKTPKANGMTSAPNPMATPVKPEKSPVKTGSSTEVSTH
HHKDPGAAYKAYSKYYSM                                               
        YKAYSKYY                                                 

© 1998-2019