BYKdb

Annotate results for A0A062VFP6

A0A062VFP6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A062VFP6
DOMAINtad2/193SSFDLKSLMSMIYRRFWLIFAGFVTVMSLVIFVTFTQTPTYRAQSVLQLDTNQINVIDLG
ALFSGAGGATTSVIDTEVRVIGSKTLLARVAEKQRLIEDPEFNWTLRPKKESLVSSAQKA
VVGLLGGDTSEKDPFAGMTAEQKEAEIFESVVGTLMTKVRVGRVGATYLLTVDVTSTSPE
TAARLANEVADQ
DOMAINcd540/730TSSLPDEGKTSLALSLGRMSAMSGSRTLVIDGDFRRRQLTEMAGLKPEIGLVEHLFGAGQ
LSDAIVKDHKTMLDILPLSLNGHTPHDVFGTRAFDELLSRLRAMYDLILIDTGPLLLMAE
ARVVAGKVDKAILVVRWRQTTRSAARQSLTLLRNFKADVLGVTLNMVDLNRRRHHRDPGA
TYKAYRKYYQM
SITEWalker A547/549GKT
SITEWalker A'567/574LVIDGDFR
SITEWalker B647/653ILIDTGP
SITEY Cluster721/728YKAYRKYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSSFDLKSLMSMIYRRFWLIFAGFVTVMSLVIFVTFTQTPTYRAQSVLQLDTNQINVIDLGALFSGAGGATTSVIDTEVR
 SSFDLKSLMSMIYRRFWLIFAGFVTVMSLVIFVTFTQTPTYRAQSVLQLDTNQINVIDLGALFSGAGGATTSVIDTEVR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VIGSKTLLARVAEKQRLIEDPEFNWTLRPKKESLVSSAQKAVVGLLGGDTSEKDPFAGMTAEQKEAEIFESVVGTLMTKV
VIGSKTLLARVAEKQRLIEDPEFNWTLRPKKESLVSSAQKAVVGLLGGDTSEKDPFAGMTAEQKEAEIFESVVGTLMTKV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RVGRVGATYLLTVDVTSTSPETAARLANEVADQYRVQQLEKKYDATRKATEWLQERVSGLRDEVEEKEQRVESFRAETGL
RVGRVGATYLLTVDVTSTSPETAARLANEVADQ                                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEAQGTTLTEQQIGYLTSQRGQAQIEVDRARARYESMRRQIDSGAGVEGVSEVINSPLINDLKTQRSIIMRRVAELETRV


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GDRHPDLISARNEVADIDRQMSAEMNRIAANLESELRVAQAQLSSIQGEIGRSTSQLRGNNVNLVRLRELERDAQTSRVM


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEEFLARSKQTREQDALITADSSILSTASVPYSPASPRKAFNLVIGALLGLIIGGFLAIIAELFDSNISSSEDVENKLGS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NPIGSVPLIRTAGLLGLGQTSPADFLVENPLSAYAESIRYLRAAIAFSDLDSETKTVAITSSLPDEGKTSLALSLGRMSA
                                                           TSSLPDEGKTSLALSLGRMSA
                                                                  GKT           
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSGSRTLVIDGDFRRRQLTEMAGLKPEIGLVEHLFGAGQLSDAIVKDHKTMLDILPLSLNGHTPHDVFGTRAFDELLSRL
MSGSRTLVIDGDFRRRQLTEMAGLKPEIGLVEHLFGAGQLSDAIVKDHKTMLDILPLSLNGHTPHDVFGTRAFDELLSRL
      LVIDGDFR                                                                  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAMYDLILIDTGPLLLMAEARVVAGKVDKAILVVRWRQTTRSAARQSLTLLRNFKADVLGVTLNMVDLNRRRHHRDPGAT
RAMYDLILIDTGPLLLMAEARVVAGKVDKAILVVRWRQTTRSAARQSLTLLRNFKADVLGVTLNMVDLNRRRHHRDPGAT
      ILIDTGP                                                                   
       730       740       750       760       770         
....:....|....:....|....:....|....:....|....:....|....:....
YKAYRKYYQMEAKPGLFGWSKPKKPKASKQGPKSAIAIQVPPSKASGRKQDPVDRISAE
YKAYRKYYQM                                                 
YKAYRKYY                                                   

© 1998-2019