BYKdb

Annotate results for A0A066PQH4

A0A066PQH4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A066PQH4
DOMAINtad16/185GTADPIDALRAVRRHWRLAVLVALGLPLLSLGALSRMRPVYTATGTLLYNPVDFNPKLLR
GVVETRQVTDALMASQAAILKSPAVVARVIDGLDLGASPEFDPARQRPSLLRRWLGSAGP
PLPVAPDALRDAVTARFHIDVPAGSQLINVSFTAHDPALAARAANAAMAA
DOMAINcd522/714TAARPGEGKTTLAVSLALSVAASGARVLVIDCDIRQPSFDMIFGLGGLPGLTDHLAGRAT
LEAAIHRPGLEEGGSLPDVMPAGAVATEALALFMSDRLGRLMAELHGRYDLVVLDLPPVF
ALAEAQLLARAAAATLLCIRWGQTPRRTVAAALALLDQGGLRLAGAALTRVDGPRHARSG
FPDSELYHPRYGG
SITEWalker A529/531GKT
SITEWalker A'549/556LVIDCDIR
SITEWalker B633/639VVLDLPP
SITEY Cluster708/715YHPRYGGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDTAAKARDRVRQIGGTADPIDALRAVRRHWRLAVLVALGLPLLSLGALSRMRPVYTATGTLLYNPVDFNPKLLRGVVET
               GTADPIDALRAVRRHWRLAVLVALGLPLLSLGALSRMRPVYTATGTLLYNPVDFNPKLLRGVVET

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RQVTDALMASQAAILKSPAVVARVIDGLDLGASPEFDPARQRPSLLRRWLGSAGPPLPVAPDALRDAVTARFHIDVPAGS
RQVTDALMASQAAILKSPAVVARVIDGLDLGASPEFDPARQRPSLLRRWLGSAGPPLPVAPDALRDAVTARFHIDVPAGS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLINVSFTAHDPALAARAANAAMAAYLARERRESLAVLDRAQAWLGQRAKATAHRLEALDVAIARERARSGTVRGAGAAP
QLINVSFTAHDPALAARAANAAMAA                                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTNEEAGQLTGSLAAARADLAAARARLAALNGGSEAEAAAAVAPEIAPMRAREAELAAKLRALGSTEGPNYPDIRATKRA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAALRGQIAAETGRLITADRMRAAAAAARVKSLKAELAAVRDRAAAQSVRAAPLARLEEERTAESDLLRAQTEQIGTLES


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HSALTRPDARIIAAATRPLQPSGPRSAAILSGAVLLGLCLGVLAALLADSLNGSFRSGGQVREALELPCMALLPEVGRRE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRGLSVPDYARRYPFSAFAEQIRALRTGLWLAPGAPRSLAVTAARPGEGKTTLAVSLALSVAASGARVLVIDCDIRQPSF
                                         TAARPGEGKTTLAVSLALSVAASGARVLVIDCDIRQPSF
                                                GKT                 LVIDCDIR    
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DMIFGLGGLPGLTDHLAGRATLEAAIHRPGLEEGGSLPDVMPAGAVATEALALFMSDRLGRLMAELHGRYDLVVLDLPPV
DMIFGLGGLPGLTDHLAGRATLEAAIHRPGLEEGGSLPDVMPAGAVATEALALFMSDRLGRLMAELHGRYDLVVLDLPPV
                                                                        VVLDLPP 
       650       660       670       680       690       700       710        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
FALAEAQLLARAAAATLLCIRWGQTPRRTVAAALALLDQGGLRLAGAALTRVDGPRHARSGFPDSELYHPRYGGYFRL
FALAEAQLLARAAAATLLCIRWGQTPRRTVAAALALLDQGGLRLAGAALTRVDGPRHARSGFPDSELYHPRYGG    
                                                                   YHPRYGGY   

© 1998-2019