BYKdb

Annotate results for A0A068NY62

A0A068NY62 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A068NY62
DOMAINtad23/169ERTELLHYGGVLRRRWPAMLVVALAVFGLVAAYTMLQRKVYEASTKLVVVTKGASIGGGD
TLLATLGAIRQSRTVDTQVEIINSFDLIDRAFRTMTPAERMNGFKSLTAPAWSYEIKSRA
ETDVILIDSRSFRPDLAARFANAIAQT
DOMAINcd529/718TSAAMAEGKSTISVNLAIAMAMDGKRVLIIDADLRRPTVHKWVGMTNEKGFTSVVRGVSS
LSDAVRSTQWDGLQVLPSGPLPPDPTEFLNSHRSKDVFQLAANEYDVVVVDAPPCTGLSD
MQVISTIVDGVVLVAALDSTSKPMMHATMRMLRQAGAPLLGLVINRIKHSNKGYYGYYGY
YGYYGYSSYQ
SITEWalker A536/538GKS
SITEWalker A'556/563LIIDADLR
SITEWalker B636/642VVVDAPP
SITEY Cluster702/717YYGYYGYYGYYGYSSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTNPKRITDDLRSGGGYDVDEQERTELLHYGGVLRRRWPAMLVVALAVFGLVAAYTMLQRKVYEASTKLVVVTKGASIGG
                      ERTELLHYGGVLRRRWPAMLVVALAVFGLVAAYTMLQRKVYEASTKLVVVTKGASIGG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GDTLLATLGAIRQSRTVDTQVEIINSFDLIDRAFRTMTPAERMNGFKSLTAPAWSYEIKSRAETDVILIDSRSFRPDLAA
GDTLLATLGAIRQSRTVDTQVEIINSFDLIDRAFRTMTPAERMNGFKSLTAPAWSYEIKSRAETDVILIDSRSFRPDLAA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RFANAIAQTYLDEDLKRNSQATRQAWEYVQREMATSRNQLAIASADLAHYKQKTGLVAAADQVSGLAKAELEVQGSLDSS
RFANAIAQT                                                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RADMLAAERNLARLKGQLRALSPEIDFQRTIAENPEFALVRANVLQLEGRLVELSQEFTPNSPEVTQVKQELQVQKDKLK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALARTTVSTEEKVRNPLLDKLASDYAEATATQVVASERAKALGGQLVKDQAALRQYPEQERHLAELQQRVDVLYRTFNML


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDRYYALLIEWRSSLPNGLVAALARPPSAHSSPRTSLNLTFGIIIALVLGLGVGVLLERLDTKLHSPEEAERATGLPALT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FVPEATTSGDRLLLGEAQPSHAFIESFRLLRNNIAFAVPDKDLRVVAVTSAAMAEGKSTISVNLAIAMAMDGKRVLIIDA
                                                TSAAMAEGKSTISVNLAIAMAMDGKRVLIIDA
                                                       GKS                 LIIDA
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLRRPTVHKWVGMTNEKGFTSVVRGVSSLSDAVRSTQWDGLQVLPSGPLPPDPTEFLNSHRSKDVFQLAANEYDVVVVDA
DLRRPTVHKWVGMTNEKGFTSVVRGVSSLSDAVRSTQWDGLQVLPSGPLPPDPTEFLNSHRSKDVFQLAANEYDVVVVDA
DLR                                                                        VVVDA
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPCTGLSDMQVISTIVDGVVLVAALDSTSKPMMHATMRMLRQAGAPLLGLVINRIKHSNKGYYGYYGYYGYYGYSSYQDD
PPCTGLSDMQVISTIVDGVVLVAALDSTSKPMMHATMRMLRQAGAPLLGLVINRIKHSNKGYYGYYGYYGYYGYSSYQ  
PP                                                           YYGYYGYYGYYGYSSY   
       730        
....:....|....:...
PAAEEKVAKTKRSRTSKK


© 1998-2019