BYKdb

Annotate results for A0A069DFE7

A0A069DFE7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A069DFE7
DOMAINcd47/229ASAQSGEGKTTTVSNLAVTYAQEGKKVLLIDTDLRKPSLHQVFTVSNHAGLSSAIAAQYP
VQEVLQKTAVHNLDVLPSGPIPPNPSEMLGSKKMTALLEERKEMYDIILFDTPPVLAVTD
AMIISSLCDGVVLVVNSGKVKKDLVKKAKGHLEHVNARILGVVLNNLQLSKNQSNYYYYY
GER
SITEWalker A54/56GKT
SITEWalker A'74/81LLIDTDLR
SITEWalker B154/160ILFDTPP
SITEY Cluster222/226YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPRSTSNQHNLVTAVNPKAPISEAYRTLRTNIQFSAIDDQIKVLMVASAQSGEGKTTTVSNLAVTYAQEGKKVLLIDTDL
                                              ASAQSGEGKTTTVSNLAVTYAQEGKKVLLIDTDL
                                                     GKT                 LLIDTDL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKPSLHQVFTVSNHAGLSSAIAAQYPVQEVLQKTAVHNLDVLPSGPIPPNPSEMLGSKKMTALLEERKEMYDIILFDTPP
RKPSLHQVFTVSNHAGLSSAIAAQYPVQEVLQKTAVHNLDVLPSGPIPPNPSEMLGSKKMTALLEERKEMYDIILFDTPP
R                                                                        ILFDTPP
       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
VLAVTDAMIISSLCDGVVLVVNSGKVKKDLVKKAKGHLEHVNARILGVVLNNLQLSKNQSNYYYYYGER
VLAVTDAMIISSLCDGVVLVVNSGKVKKDLVKKAKGHLEHVNARILGVVLNNLQLSKNQSNYYYYYGER
                                                             YYYYY   
© 1998-2019