BYKdb

Annotate results for A0A069PEZ2

A0A069PEZ2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A069PEZ2
DOMAINtad18/273DEISLSEVLTVLRENRKLIAIATACALSIGSLYAFLWAPTYRADVLIQVDDDSGAGSLND
KLGDLAALFQNKASADAEIELMRSRNVVGDAVNRLHLDIDARPHYVPIVGAPYVRYTAGS
GLASAAFGLGSFAWGGERIGVSEFTVPSTQYEKTFTLIARDGERYELVSPDGDTILRGRV
GETASAGGVTLTVRSLLARSGTRFDLKRFSTQQTIADLQDALKIAEKTKQSGIVGMSLDG
KDAELTATTVNAIAAL
DOMAINcd550/733TGARPGIGKSFISVNLAAVIAAGGARVLLIDGDMRRGNLSGVLGLKREPGFSNLLRDAEP
DAVINRNVLPGLDVITGGGMPDRPSELLMNERLASVLKRLRERYDYVIIDSPPVLAVTDA
GLIGRHVDASLLVVRHGRHTAAELRETTRQLANAGVPLHGALLTDTPASGTAYGAYSQYA
ATGS
SITEWalker A557/559GKS
SITEWalker A'577/584LLIDGDMR
SITEWalker B656/662VIIDSPP
SITE-653/-655YDY
SITEY Cluster722/728YGAYSQY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKDMQQPPNQSRSTPDNDEISLSEVLTVLRENRKLIAIATACALSIGSLYAFLWAPTYRADVLIQVDDDSGAGSLNDKLG
                 DEISLSEVLTVLRENRKLIAIATACALSIGSLYAFLWAPTYRADVLIQVDDDSGAGSLNDKLG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLAALFQNKASADAEIELMRSRNVVGDAVNRLHLDIDARPHYVPIVGAPYVRYTAGSGLASAAFGLGSFAWGGERIGVSE
DLAALFQNKASADAEIELMRSRNVVGDAVNRLHLDIDARPHYVPIVGAPYVRYTAGSGLASAAFGLGSFAWGGERIGVSE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FTVPSTQYEKTFTLIARDGERYELVSPDGDTILRGRVGETASAGGVTLTVRSLLARSGTRFDLKRFSTQQTIADLQDALK
FTVPSTQYEKTFTLIARDGERYELVSPDGDTILRGRVGETASAGGVTLTVRSLLARSGTRFDLKRFSTQQTIADLQDALK

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IAEKTKQSGIVGMSLDGKDAELTATTVNAIAALYVQRNVDRKSAQAQQMLAFLADQLPQLRADLDRAEARYNAFRAKNGA
IAEKTKQSGIVGMSLDGKDAELTATTVNAIAAL                                               

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDLEEQSKLLLQSAVENRSKIVELEQKRAELVQRYTAHHPEVVAIDASIGELKRQSGDFDHRISALPSVQQDAVRLLRDV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVSNDLYTSLLNSTQQLSVLKAGQLGNVRTVDYAVTPEKPVAPKKALALVLSVLLGLVAGCSLALGRRMFNRGLETPAEI


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ESAIDLPVLAIISHSPREAALAASRRRGSSKHRVLAALAPNDVAVEGLRSLRTALQFGVLKQRNMIVMVTGARPGIGKSF
                                                                     TGARPGIGKSF
                                                                            GKS 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISVNLAAVIAAGGARVLLIDGDMRRGNLSGVLGLKREPGFSNLLRDAEPDAVINRNVLPGLDVITGGGMPDRPSELLMNE
ISVNLAAVIAAGGARVLLIDGDMRRGNLSGVLGLKREPGFSNLLRDAEPDAVINRNVLPGLDVITGGGMPDRPSELLMNE
                LLIDGDMR                                                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLASVLKRLRERYDYVIIDSPPVLAVTDAGLIGRHVDASLLVVRHGRHTAAELRETTRQLANAGVPLHGALLTDTPASGT
RLASVLKRLRERYDYVIIDSPPVLAVTDAGLIGRHVDASLLVVRHGRHTAAELRETTRQLANAGVPLHGALLTDTPASGT
               VIIDSPP                                                          
       730   
....:....|...
AYGAYSQYAATGS
AYGAYSQYAATGS
 YGAYSQY     

© 1998-2019