BYKdb

Annotate results for A0A069RC75

A0A069RC75 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A069RC75
DOMAINtad1/137MNGKKYIGIFKRRKWLFFMVLAVSVAVSAVMTFYVSEPEYSSYTTLMVNKARGDNENYID
YESYIISQKLVDTYAVVAKSETVMERTIKNLNLRVSPQKLLKKVKIDQVDETEVLKISAS
STDPALAAAIANEIAQV
DOMAINcd264/442TSSIPGEGKTLVSANMATALCGIGKKVMLFDCDFRKPRLAKVFGLSNTVGITDALMSKRD
YREFVKETHIENLHIMTAGNSVQNPAELLQSERIRELIRKIENDYDYIIVDTPPATAVTD
ASIVSTFSDAAVIVCSSGIVDIDELKRAKAQLEGVNARIMGAIFNRASEASSYYSYYGK
SITEWalker A271/273GKT
SITEWalker A'291/298MLFDCDFR
SITEWalker B371/377IIVDTPP
SITE-368/-370YDY
SITEY Cluster436/440YYSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNGKKYIGIFKRRKWLFFMVLAVSVAVSAVMTFYVSEPEYSSYTTLMVNKARGDNENYIDYESYIISQKLVDTYAVVAKS
MNGKKYIGIFKRRKWLFFMVLAVSVAVSAVMTFYVSEPEYSSYTTLMVNKARGDNENYIDYESYIISQKLVDTYAVVAKS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ETVMERTIKNLNLRVSPQKLLKKVKIDQVDETEVLKISASSTDPALAAAIANEIAQVFKEEIFRIMNDENVRVIDYAKIP
ETVMERTIKNLNLRVSPQKLLKKVKIDQVDETEVLKISASSTDPALAAAIANEIAQV                       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVPSKPDKILNMAAGVFFGIMGGLLVVYVLEYFDNAVRSAEDIQNGIGISVIGSVPKLKMSGEKGAELVIKTSPKSPGAE


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AFRSIRTNMQFANIDQNIKTILFTSSIPGEGKTLVSANMATALCGIGKKVMLFDCDFRKPRLAKVFGLSNTVGITDALMS
                       TSSIPGEGKTLVSANMATALCGIGKKVMLFDCDFRKPRLAKVFGLSNTVGITDALMS
                              GKT                 MLFDCDFR                      
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRDYREFVKETHIENLHIMTAGNSVQNPAELLQSERIRELIRKIENDYDYIIVDTPPATAVTDASIVSTFSDAAVIVCSS
KRDYREFVKETHIENLHIMTAGNSVQNPAELLQSERIRELIRKIENDYDYIIVDTPPATAVTDASIVSTFSDAAVIVCSS
                                                  IIVDTPP                       
       410       420       430       440  
....:....|....:....|....:....|....:....|..
GIVDIDELKRAKAQLEGVNARIMGAIFNRASEASSYYSYYGK
GIVDIDELKRAKAQLEGVNARIMGAIFNRASEASSYYSYYGK
                                   YYSYY  
© 1998-2019