BYKdb

Annotate results for A0A069RKE1

A0A069RKE1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A069RKE1
DOMAINcd43/234TSSKQAEGKSTTVANLAVTMANMGKKVVIVDGDLRRPRVHKIFGHTKIGGVTEILLSHCS
YKGCVKKTEVENLDIITSGQTPPNPSEMLSSNSMKQILEEVRNDYDYVFIDSPPVAAVAD
AVILSGMADGVVLVCACGRVEVDMVRNTLQALENAGAYVIGSVINNIDVHDKKSGYYYYS
PSYYGYCEDSNE
SITEWalker A50/52GKS
SITEWalker A'70/77VIVDGDLR
SITEWalker B150/156VFIDSPP
SITE-147/-149YDY
SITEY Cluster218/228YYYYSPSYYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNLLNELIVYQKPKSPISEAYRSLRTNIEFANVDNDKKLILITSSKQAEGKSTTVANLAVTMANMGKKVVIVDGDLRRPR
                                          TSSKQAEGKSTTVANLAVTMANMGKKVVIVDGDLRRPR
                                                 GKS                 VIVDGDLR   
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VHKIFGHTKIGGVTEILLSHCSYKGCVKKTEVENLDIITSGQTPPNPSEMLSSNSMKQILEEVRNDYDYVFIDSPPVAAV
VHKIFGHTKIGGVTEILLSHCSYKGCVKKTEVENLDIITSGQTPPNPSEMLSSNSMKQILEEVRNDYDYVFIDSPPVAAV
                                                                     VFIDSPP    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADAVILSGMADGVVLVCACGRVEVDMVRNTLQALENAGAYVIGSVINNIDVHDKKSGYYYYSPSYYGYCEDSNEKRKRKK
ADAVILSGMADGVVLVCACGRVEVDMVRNTLQALENAGAYVIGSVINNIDVHDKKSGYYYYSPSYYGYCEDSNE      
                                                         YYYYSPSYYGY            
       250       
....:....|....:..
RKKKQAQSGLKAASGND


© 1998-2019