BYKdb

Annotate results for A0A070SUN0

A0A070SUN0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A070SUN0
DOMAINtad18/254DEIDLGRLLGYLIDGRWWIVSITAFFMVIGISYALLATPIYKANALLQVEKKTSGAALLG
NMADMLGGEQPDAAAEIELLTSRMVLGRTVQELNLDTVVKPDFFPVIGRGLSRLLGNPYP
KIAISRFAVTPDLIGTPLSLTVTNNSHFILDVDGNEIEGQVGKLLDTKGVTLLINDVAAD
DGQQFTLVKKPTLDVIGDLQRQIQVSEKGKNTGIISLSLEGDDKARIRAILDNISQN
DOMAINcd534/722SGSGPGLGKTFVSTNFAATLALGGKKVLVIDADLRKGYMQKVMGQNMGTGLSAYLSGQYD
IAQTISKTAFDGLDFVSRGAVPPNPSELLMHPRFKALLDWASEHYDFVLVDSPPILAVTD
AAIIGQHAGTSLLVARFAKTAVKEVDVAVRRFEQNGIAIKGILLNAVEKKASSYYGNYGY
YQYSYADKK
SITEWalker A541/543GKT
SITEWalker A'561/568LVIDADLR
SITEWalker B641/647VLVDSPP
SITE-587/-592YLSGQY
SITEY Cluster707/718YYGNYGYYQYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTTSSVTSRQSNAAVENDEIDLGRLLGYLIDGRWWIVSITAFFMVIGISYALLATPIYKANALLQVEKKTSGAALLGNMA
                 DEIDLGRLLGYLIDGRWWIVSITAFFMVIGISYALLATPIYKANALLQVEKKTSGAALLGNMA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DMLGGEQPDAAAEIELLTSRMVLGRTVQELNLDTVVKPDFFPVIGRGLSRLLGNPYPKIAISRFAVTPDLIGTPLSLTVT
DMLGGEQPDAAAEIELLTSRMVLGRTVQELNLDTVVKPDFFPVIGRGLSRLLGNPYPKIAISRFAVTPDLIGTPLSLTVT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NNSHFILDVDGNEIEGQVGKLLDTKGVTLLINDVAADDGQQFTLVKKPTLDVIGDLQRQIQVSEKGKNTGIISLSLEGDD
NNSHFILDVDGNEIEGQVGKLLDTKGVTLLINDVAADDGQQFTLVKKPTLDVIGDLQRQIQVSEKGKNTGIISLSLEGDD

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KARIRAILDNISQNYLQQNVLRKTEEAQKSLDFLKTHLPQVKEELNRAEEQLNVYRQQNESVDLSLEAKAALDTMVGIEK
KARIRAILDNISQN                                                                  

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLNELTFREAELQQLYTRQHPAYIALLEKRQTLLNTKNTINKSIKRLPKTQQEILRLTRDVQVGQEIFVQLLNKQQELNI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKAGTIGNVRIIDEAAVETRAVKPKKPLIVVLATLLGGMLSVGLILIRAAFHRGIESPEQLEEMGLSVYATIPYSSEQAT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IEQKQKKHQKALPINEALLAARNPADLAMESLRSLRTSLHFAMIEAKNNIIMISGSGPGLGKTFVSTNFAATLALGGKKV
                                                     SGSGPGLGKTFVSTNFAATLALGGKKV
                                                            GKT                 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVIDADLRKGYMQKVMGQNMGTGLSAYLSGQYDIAQTISKTAFDGLDFVSRGAVPPNPSELLMHPRFKALLDWASEHYDF
LVIDADLRKGYMQKVMGQNMGTGLSAYLSGQYDIAQTISKTAFDGLDFVSRGAVPPNPSELLMHPRFKALLDWASEHYDF
LVIDADLR                                                                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLVDSPPILAVTDAAIIGQHAGTSLLVARFAKTAVKEVDVAVRRFEQNGIAIKGILLNAVEKKASSYYGNYGYYQYSYAD
VLVDSPPILAVTDAAIIGQHAGTSLLVARFAKTAVKEVDVAVRRFEQNGIAIKGILLNAVEKKASSYYGNYGYYQYSYAD
VLVDSPP                                                           YYGNYGYYQYSY  
    
....
KKKN
KK  

© 1998-2019