BYKdb

Annotate results for A0A071IND6

A0A071IND6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A071IND6
DOMAINtad20/203GFIDLDRLMAVVIRRIRTIMLGVAVFVGLAIAYLLFATPSYTSATQILLDETMTKYAEDQ
PPPTSSQQADMDIASAVEILKSNEMALRVVDTAGLIDNDAFVNPPQSPVALIKSGVKLIA
SVFKPAKPPLTPAEAREAKRQLIAAMLQDALKVERVTRSSVVLVSFSSTDPLLAAKITSA
YADS
DOMAINcd579/770VSALPGEGKSTTAANFAALLASSGKRTLLIDADLRNPGLSRTLKTPPQVGLIEAALGEVP
WASAVKVDPRTKLAILPVVIRDHLLHTSELLSSQGMMTLMENARKMFDYIVVDLAPLGPV
IDAKAFAPQVDAFLLVAEWGATPTSLVRDLLEQEPQINSRVLGVILNKTDMSELARYSEF
GATERYRQKYVS
SITEWalker A586/588GKS
SITEWalker A'606/613LLIDADLR
SITEWalker B688/694IVVDLAP
SITEY Cluster764/772YRQKYVSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MHQKNFTFHSATPKAEEQDGFIDLDRLMAVVIRRIRTIMLGVAVFVGLAIAYLLFATPSYTSATQILLDETMTKYAEDQP
                   GFIDLDRLMAVVIRRIRTIMLGVAVFVGLAIAYLLFATPSYTSATQILLDETMTKYAEDQP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPTSSQQADMDIASAVEILKSNEMALRVVDTAGLIDNDAFVNPPQSPVALIKSGVKLIASVFKPAKPPLTPAEAREAKRQ
PPTSSQQADMDIASAVEILKSNEMALRVVDTAGLIDNDAFVNPPQSPVALIKSGVKLIASVFKPAKPPLTPAEAREAKRQ

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIAAMLQDALKVERVTRSSVVLVSFSSTDPLLAAKITSAYADSYLTDQLNANFDATERASVWLQERLNDLRQRAQMASLE
LIAAMLQDALKVERVTRSSVVLVSFSSTDPLLAAKITSAYADS                                     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VEKYKAENGLTSTGGELMSEQQISDLNKQLIIAQADTASASARYNQYKSIIDQGPDNAVKNATISSSQSGNSVLQDLKTR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YLAVQKREQDVTQNFGADHPQAVALKAERQDITRQIYEELQQLTASYKNEFDVAQSRATSLRGSIEGMVGKNSEANKSLV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLNELNQKATALKTLYESYLGRFEAAAQQRSFPIAKARVISAAGVPTAPSSPKKTLVMALSIILGLMAGGGFAAFQEFRD


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RFFRVEADVRAALGLKFLGYLPLLGQQGFPKKKNKRKAGPVPAMATATADEGENGVAFERIMRVSVEAPRSMFAETLRNA


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLASDVMLQGRADRVIGVVSALPGEGKSTTAANFAALLASSGKRTLLIDADLRNPGLSRTLKTPPQVGLIEAALGEVPWA
                  VSALPGEGKSTTAANFAALLASSGKRTLLIDADLRNPGLSRTLKTPPQVGLIEAALGEVPWA
                         GKS                 LLIDADLR                           
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAVKVDPRTKLAILPVVIRDHLLHTSELLSSQGMMTLMENARKMFDYIVVDLAPLGPVIDAKAFAPQVDAFLLVAEWGAT
SAVKVDPRTKLAILPVVIRDHLLHTSELLSSQGMMTLMENARKMFDYIVVDLAPLGPVIDAKAFAPQVDAFLLVAEWGAT
                                               IVVDLAP                          
       730       740       750       760       770       780   
....:....|....:....|....:....|....:....|....:....|....:....|...
PTSLVRDLLEQEPQINSRVLGVILNKTDMSELARYSEFGATERYRQKYVSYYTEDHPKTQVEA
PTSLVRDLLEQEPQINSRVLGVILNKTDMSELARYSEFGATERYRQKYVS             
                                           YRQKYVSYY           

© 1998-2019