BYKdb

Annotate results for A0A071M1R0

A0A071M1R0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A071M1R0
DOMAINtad16/252DEIDIGRLIGTVIEARWWVLGITALFAMVAVTYVMFATPIYKADALVQIEQNGSSSLVQD
INSALQNKAPQSDAEMQLITSRMVLGKTVDDLNLDIDVEKKTFPVFGAGWDRLMGRQNES
VTVSTFNVPKAMHKDEFTLEVLSPTRYRFTSNNGFSAEGRVGQPLTKNGLTLLVSGINAH
EGSEFTVTKYSTLGMINQLTNSLTVAENGKDTGVLSLTYTGADRDQIREILNSITRN
DOMAINcd542/729TGVSPSIGKTFVCANLAAVISQTNKKVLLIDCDMRKGYTHELLGCSNQHGLSDVLADNSP
LEKAARPTTIANFDLIPRGQIPPNPSELLMSERFEALINWASKNYELVLIDTPPILAVTD
AAVVGRHAGTTLMVARYAVNTLKEVETSLGRFEQNGVQVKGVILNSIFRRASGYQDYGYY
EYEYKSDA
SITEWalker A549/551GKT
SITEWalker A'569/576LLIDCDMR
SITEWalker B649/655VLIDTPP
SITEY Cluster715/725YQDYGYYEYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTERIKHASASSDGSDEIDIGRLIGTVIEARWWVLGITALFAMVAVTYVMFATPIYKADALVQIEQNGSSSLVQDINSAL
               DEIDIGRLIGTVIEARWWVLGITALFAMVAVTYVMFATPIYKADALVQIEQNGSSSLVQDINSAL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QNKAPQSDAEMQLITSRMVLGKTVDDLNLDIDVEKKTFPVFGAGWDRLMGRQNESVTVSTFNVPKAMHKDEFTLEVLSPT
QNKAPQSDAEMQLITSRMVLGKTVDDLNLDIDVEKKTFPVFGAGWDRLMGRQNESVTVSTFNVPKAMHKDEFTLEVLSPT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYRFTSNNGFSAEGRVGQPLTKNGLTLLVSGINAHEGSEFTVTKYSTLGMINQLTNSLTVAENGKDTGVLSLTYTGADRD
RYRFTSNNGFSAEGRVGQPLTKNGLTLLVSGINAHEGSEFTVTKYSTLGMINQLTNSLTVAENGKDTGVLSLTYTGADRD

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QIREILNSITRNYLEQNVERKSEEAAKSLDFLAKQLPVVRHNLDAAESKLNTYRQQKDSVDLSLEAKSVLDSMVNIDSQL
QIREILNSITRN                                                                    

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NELTFKEAEISKLYTKAHPSYRTLLEQRQVLENEKAQLGKRIAAMPKTQQEVVQLTRDVESGQQVYMQLLNRQQELKIQK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASTVGDVRIVDPAVTEPGIVKPRGALVILGSIILGLMLSIVGVLLRSLLNRGIESPQVLEEAGISVYASIPLSEWQKARD


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NAGKSGSKVKHLKGSATNRRYKQSELLAVGNPTDLAIEAVRSLRTSLHFAMMQASNNVLMMTGVSPSIGKTFVCANLAAV
                                                             TGVSPSIGKTFVCANLAAV
                                                                    GKT         
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISQTNKKVLLIDCDMRKGYTHELLGCSNQHGLSDVLADNSPLEKAARPTTIANFDLIPRGQIPPNPSELLMSERFEALIN
ISQTNKKVLLIDCDMRKGYTHELLGCSNQHGLSDVLADNSPLEKAARPTTIANFDLIPRGQIPPNPSELLMSERFEALIN
        LLIDCDMR                                                                
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WASKNYELVLIDTPPILAVTDAAVVGRHAGTTLMVARYAVNTLKEVETSLGRFEQNGVQVKGVILNSIFRRASGYQDYGY
WASKNYELVLIDTPPILAVTDAAVVGRHAGTTLMVARYAVNTLKEVETSLGRFEQNGVQVKGVILNSIFRRASGYQDYGY
        VLIDTPP                                                           YQDYGY
       730
....:....|
YEYEYKSDAK
YEYEYKSDA 
YEYEY     

© 1998-2019