BYKdb

Annotate results for A0A072BTY8

A0A072BTY8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A072BTY8
DOMAINtad30/205DNLDLASAFRMLRRRRFMIIAITVLLMAPAAVTISGLKPTYQAWARLIVHQPLATSLGAE
DTGRGDLLDVKSETERLLSRSIAERVVREMRLDARQEFNPALRKVSFFESMRASLRGLFE
TKKPTSPERDGIEATIREFYQALGVWHEDKSEVIQISFTANDAELAAAVPNRVVSI
DOMAINcd543/728TSAHSGEGKSLVARSLAIELAAAAIPVLLVDGDLRRGELDSFFRSGLQQGLNEYLNGHAD
IRDIVYHHPGGIDFIPSGKFSLQRRARSNGLAEIIEMAGAAGRVVIFDSAPVLASTDTVL
LTALAEKTLAVVRWGKTSRRAVEFSLQQMKSQRNSEIIVAINNVNPEKHALYNFSDSELF
SKSLMK
SITE-677/-679GKT
SITEWalker A'570/577LLVDGDLR
SITEWalker B647/653VIFDSAP
SITEY Cluster729/730YY
SITEWalker A550/552GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTISTVPPDRNLPISPMRYDPRAQIETKADNLDLASAFRMLRRRRFMIIAITVLLMAPAAVTISGLKPTYQAWARLIVHQ
                             DNLDLASAFRMLRRRRFMIIAITVLLMAPAAVTISGLKPTYQAWARLIVHQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PLATSLGAEDTGRGDLLDVKSETERLLSRSIAERVVREMRLDARQEFNPALRKVSFFESMRASLRGLFETKKPTSPERDG
PLATSLGAEDTGRGDLLDVKSETERLLSRSIAERVVREMRLDARQEFNPALRKVSFFESMRASLRGLFETKKPTSPERDG

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IEATIREFYQALGVWHEDKSEVIQISFTANDAELAAAVPNRVVSIYLDERKSSVRARLDAAEAWIRQRIAEQKARAVIAR
IEATIREFYQALGVWHEDKSEVIQISFTANDAELAAAVPNRVVSI                                   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAARNYQESMDIVSKEDAQDERIKTLLDLTGREGKIEESRVEIKATISALEAADNPSVAVQNIVVPDSIATKQRDLRAQQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DDLARLLELYDGKAEAVVDLRRKIEQSRLDLDLATKQYLQSMRAKLAALDHEANAVQSILAVAEQKRTRDALAQAELTRL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QHIAEKEQAALDKLEDQRRDLAAKAMLPGAELEVFSPASVPLVSQGRGRLFYLVGTLLAAISAAVTAAFALEMWDQSVRS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FDQIAGMARTIPAGLIPRLARKENPKTVFRLAPVPMFDEAIRTVILTLKQSNGGKLPNSIVVTSAHSGEGKSLVARSLAI
                                                              TSAHSGEGKSLVARSLAI
                                                                     GKS        
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELAAAAIPVLLVDGDLRRGELDSFFRSGLQQGLNEYLNGHADIRDIVYHHPGGIDFIPSGKFSLQRRARSNGLAEIIEMA
ELAAAAIPVLLVDGDLRRGELDSFFRSGLQQGLNEYLNGHADIRDIVYHHPGGIDFIPSGKFSLQRRARSNGLAEIIEMA
         LLVDGDLR                                                               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GAAGRVVIFDSAPVLASTDTVLLTALAEKTLAVVRWGKTSRRAVEFSLQQMKSQRNSEIIVAINNVNPEKHALYNFSDSE
GAAGRVVIFDSAPVLASTDTVLLTALAEKTLAVVRWGKTSRRAVEFSLQQMKSQRNSEIIVAINNVNPEKHALYNFSDSE
      VIFDSAP                                                                   
       730       740       750  
....:....|....:....|....:....|..
LFSKSLMKYYQLHTADSSSSTIKNMFSLKSQR
LFSKSLMK                        
        YY                      

© 1998-2019