BYKdb

Annotate results for A0A072NPK6

A0A072NPK6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A072NPK6
DOMAINcd55/235TSSGPGEGKSTTTANLAVVFAQQNKKVLLIDGDLRKPTVHYTFQLDNTIGLTNILTGQST
CDAAVKSSEVEHLSVLTCGPIPPNPAEMLGSDAMKKLLEHVAEQFDIIIIDSPPVLAVTD
AQILANLTDGIVLVTKSGQTEYDMAIRATELLKNSRAKLLGAVLNHKDQKQSNYYYYYGN
K
SITEWalker A62/64GKS
SITEWalker A'82/89LLIDGDLR
SITEWalker B162/168IIIDSPP
SITEY Cluster228/232YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNLRRKKKLNTTNSKFRSLITHFDKKSPISEQYRTIRTNIEFSAVDKSYKTIVVTSSGPGEGKSTTTANLAVVFAQQNKK
                                                      TSSGPGEGKSTTTANLAVVFAQQNKK
                                                             GKS                
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLLIDGDLRKPTVHYTFQLDNTIGLTNILTGQSTCDAAVKSSEVEHLSVLTCGPIPPNPAEMLGSDAMKKLLEHVAEQFD
VLLIDGDLRKPTVHYTFQLDNTIGLTNILTGQSTCDAAVKSSEVEHLSVLTCGPIPPNPAEMLGSDAMKKLLEHVAEQFD
 LLIDGDLR                                                                       
       170       180       190       200       210       220       230     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
IIIIDSPPVLAVTDAQILANLTDGIVLVTKSGQTEYDMAIRATELLKNSRAKLLGAVLNHKDQKQSNYYYYYGNK
IIIIDSPPVLAVTDAQILANLTDGIVLVTKSGQTEYDMAIRATELLKNSRAKLLGAVLNHKDQKQSNYYYYYGNK
 IIIDSPP                                                           YYYYY   
© 1998-2019