BYKdb

Annotate results for A0A073I794

A0A073I794 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A073I794
DOMAINtad14/257DFIRIQDLWEMFVPRWRWFALSLFVTLVVAVLYLLSTPNIYTRTAAILVKDDSKGGTSTN
ASSEFSDLGIFKSNTNINNELLTLKSPTLMTEVVQRLGLNEAYTVRKGLKVVELYKSSPI
TVTCSHLNEKSVSFTIDILSKDTFAISDMEVNGKAFGEDFSEKMGDSIRIETGKLVINPT
KYWNDSFVGTSIRYGKGDVRAITDYYTTALRAELGNEDATIINLSIDDASIQKAEDILNT
LIEV
DOMAINcd602/790TSFNPGSGKSFLAMNIAMSFAIKKKRILVIDGDLRHGSISSYVDFPKVGLSDYLGNRVNS
WKEIIVKDKQYDNLHILPIGIIPPNPTELLEDDKLISLIGALRSEYDYIFIDCPPIDIVA
DAQIIEKLADRTVFVVRSGLLDRSMLSELENICQEKRFKNLGVILNGTESVGGRYSYRYG
YRYGYHNGS
SITEWalker A609/611GKS
SITEWalker A'629/636LVIDGDLR
SITEWalker B710/716IFIDCPP
SITE-707/-709YDY
SITEY Cluster776/793YSYRYGYRYGYHNGSYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTEKKTTVGKPVDDFIRIQDLWEMFVPRWRWFALSLFVTLVVAVLYLLSTPNIYTRTAAILVKDDSKGGTSTNASSEFSD
             DFIRIQDLWEMFVPRWRWFALSLFVTLVVAVLYLLSTPNIYTRTAAILVKDDSKGGTSTNASSEFSD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGIFKSNTNINNELLTLKSPTLMTEVVQRLGLNEAYTVRKGLKVVELYKSSPITVTCSHLNEKSVSFTIDILSKDTFAIS
LGIFKSNTNINNELLTLKSPTLMTEVVQRLGLNEAYTVRKGLKVVELYKSSPITVTCSHLNEKSVSFTIDILSKDTFAIS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DMEVNGKAFGEDFSEKMGDSIRIETGKLVINPTKYWNDSFVGTSIRYGKGDVRAITDYYTTALRAELGNEDATIINLSID
DMEVNGKAFGEDFSEKMGDSIRIETGKLVINPTKYWNDSFVGTSIRYGKGDVRAITDYYTTALRAELGNEDATIINLSID

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DASIQKAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIEGELGNVDENISSYKSEHLLPDVQAASNLYMTQSAE
DASIQKAEDILNTLIEV                                                               

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NKKELLALNSQLSTVQYIRKELNNKEFTQPLPTNSGIANVNIESQISEYNTMVLDRNRLIANSSEKNPLVKDMANSLQSM


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRTIIQSVDNLIVSLNTQIRSIRQQEAATTQQLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ITAPRGSMFPTSPQKMNILLVAFAIGLLIPAVIIFIMENIMNTKVRGRKDLESLSIPFIGEIPQFFIQKKKLGFNNKIQP


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DMRSIVVKEGSRDIINEAFRVLRSNIDFMLGKNSRQNVFVITSFNPGSGKSFLAMNIAMSFAIKKKRILVIDGDLRHGSI
                                         TSFNPGSGKSFLAMNIAMSFAIKKKRILVIDGDLRHGSI
                                                GKS                 LVIDGDLR    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSYVDFPKVGLSDYLGNRVNSWKEIIVKDKQYDNLHILPIGIIPPNPTELLEDDKLISLIGALRSEYDYIFIDCPPIDIV
SSYVDFPKVGLSDYLGNRVNSWKEIIVKDKQYDNLHILPIGIIPPNPTELLEDDKLISLIGALRSEYDYIFIDCPPIDIV
                                                                     IFIDCPP    
       730       740       750       760       770       780       790       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
ADAQIIEKLADRTVFVVRSGLLDRSMLSELENICQEKRFKNLGVILNGTESVGGRYSYRYGYRYGYHNGSYYYGSNA
ADAQIIEKLADRTVFVVRSGLLDRSMLSELENICQEKRFKNLGVILNGTESVGGRYSYRYGYRYGYHNGS       
                                                       YSYRYGYRYGYHNGSYYY    

© 1998-2019