BYKdb

Annotate results for A0A074IX11

A0A074IX11 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A074IX11
DOMAINcd41/233SSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLSGTFKSNEPYKGLSNFLSGNA
DLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVI
DAVIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKIDMTVDKYGSYGS
YGSYGEYGKKSDQ
SITEWalker A48/50GKS
SITEWalker A'68/75LLIDADTR
SITEWalker B149/155VIIDTPP
SITE-146/-148YDY
SITEY Cluster215/227YGSYGSYGSYGEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPLLKLVKSKENFAKQTEEYYNAIRTNIQFSGAQMKVIAVSSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
                                        SSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
                                               GKS                 LLIDADTR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVI
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVI
                                                                    VIIDTPP     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAVIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKIDMTVDKYGSYGSYGSYGEYGKKSDQKEGHSRA
DAVIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKIDMTVDKYGSYGSYGSYGEYGKKSDQ       
                                                      YGSYGSYGSYGEY             
      
....:.
HRRRKG


© 1998-2019