BYKdb

Annotate results for A0A074M9Y7

A0A074M9Y7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A074M9Y7
DOMAINtad36/205PLLDLSTIRGMLYRQRWLLAGVVVASLIAGLIITLLSTPMYEARSTVRVEPYGQFIVEGQ
DVEAGIASNQVFDFLQTQLAVIKSRNLATTVAQNLNLGERSALLGADFDESRPPNMTDEQ
WLQAKNEAAAGQLQSQVAAAIPDDNWIITISYRSSDPVLAAELANAYADA
DOMAINcd543/733TSTEASEGKSTTAVILAELFARMGRKTLLIDADLRRPTIAKLLDIEKPKVGLVEVLLGHV
KLEDAIIKGVHDNLDILAIAEIPASPTELLAESYVGELIAKHRNDYSLIIFDSSPVMGLA
DAPMLSRVVDGTIFVMEANRISFGKAKTAKRRLQASGAKMLGVILTKYRALEAGQDYSYQ
YSYYQYGGTKE
SITEWalker A550/552GKS
SITEWalker A'570/577LLIDADLR
SITEWalker B651/657IIFDSSP
SITEY Cluster719/728YSYQYSYYQY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNDRSLMQAPGQDPRQGWVDAYMPDGQVGHFEPPRPLLDLSTIRGMLYRQRWLLAGVVVASLIAGLIITLLSTPMYEARS
                                   PLLDLSTIRGMLYRQRWLLAGVVVASLIAGLIITLLSTPMYEARS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVRVEPYGQFIVEGQDVEAGIASNQVFDFLQTQLAVIKSRNLATTVAQNLNLGERSALLGADFDESRPPNMTDEQWLQAK
TVRVEPYGQFIVEGQDVEAGIASNQVFDFLQTQLAVIKSRNLATTVAQNLNLGERSALLGADFDESRPPNMTDEQWLQAK

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NEAAAGQLQSQVAAAIPDDNWIITISYRSSDPVLAAELANAYADAFAESDTRSSIETNEYAQEYLLDQINLIRVRLQEAE
NEAAAGQLQSQVAAAIPDDNWIITISYRSSDPVLAAELANAYADA                                   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EATNNYARGAQIILQPGEGEDAAPTTLTSTNLSSANARFSAARADRIAAEQKWRAIQNAPADQLPAVQTNSVLQGLVSDK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISKEGELIELRQRYNDEFPQIQNLLQQIAVLDRQIADRGNAIKASIRNDYIVARNQEQALQAELNSLTGETLSEQDDQVQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSVLEREAEALRGQLESLLTRYNQVTSAANVDAGAFNKLDSAVVPSTPYAPSLSVNLTMALVAGIALAGGLALLRETFDD


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RIRSLEEVEDKLGLPLFGQTPYVDERDIEVFGNDFSTLMESYASIRSSIDFSLSRERNVLQFTSTEASEGKSTTAVILAE
                                                              TSTEASEGKSTTAVILAE
                                                                     GKS        
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LFARMGRKTLLIDADLRRPTIAKLLDIEKPKVGLVEVLLGHVKLEDAIIKGVHDNLDILAIAEIPASPTELLAESYVGEL
LFARMGRKTLLIDADLRRPTIAKLLDIEKPKVGLVEVLLGHVKLEDAIIKGVHDNLDILAIAEIPASPTELLAESYVGEL
         LLIDADLR                                                               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IAKHRNDYSLIIFDSSPVMGLADAPMLSRVVDGTIFVMEANRISFGKAKTAKRRLQASGAKMLGVILTKYRALEAGQDYS
IAKHRNDYSLIIFDSSPVMGLADAPMLSRVVDGTIFVMEANRISFGKAKTAKRRLQASGAKMLGVILTKYRALEAGQDYS
          IIFDSSP                                                             YS
       730   
....:....|...
YQYSYYQYGGTKE
YQYSYYQYGGTKE
YQYSYYQY     

© 1998-2019