BYKdb

Annotate results for A0A075JRS9

A0A075JRS9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A075JRS9
DOMAINcd53/233TSSGPSEGKSMTTANLAVVYAQQGKKVLLIDADLRKPTVHYTFRLDNLRGLSNVLVGEHT
VEETVNRTDVDNLDVISSGPIPPNPSELLASRKMQTFLDDAKQSYDLVIFDTPPVLAVTD
SQILANIVDGTLLVIRSKKTELEAAQKAKEALEPAKAKLLGTVLNDREKKGSNYYYYYGT
N
SITEWalker A60/62GKS
SITEWalker A'80/87LLIDADLR
SITEWalker B160/166VIFDTPP
SITEY Cluster226/230YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARRKNQSRPNNKMRHLIAKLNPKSPITEQYRTIRTNLQFASVDEELTSMLVTSSGPSEGKSMTTANLAVVYAQQGKKVL
                                                    TSSGPSEGKSMTTANLAVVYAQQGKKVL
                                                           GKS                 L
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIDADLRKPTVHYTFRLDNLRGLSNVLVGEHTVEETVNRTDVDNLDVISSGPIPPNPSELLASRKMQTFLDDAKQSYDLV
LIDADLRKPTVHYTFRLDNLRGLSNVLVGEHTVEETVNRTDVDNLDVISSGPIPPNPSELLASRKMQTFLDDAKQSYDLV
LIDADLR                                                                        V
       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
IFDTPPVLAVTDSQILANIVDGTLLVIRSKKTELEAAQKAKEALEPAKAKLLGTVLNDREKKGSNYYYYYGTN
IFDTPPVLAVTDSQILANIVDGTLLVIRSKKTELEAAQKAKEALEPAKAKLLGTVLNDREKKGSNYYYYYGTN
IFDTPP                                                           YYYYY   
© 1998-2019