BYKdb

Annotate results for A0A075KI59

A0A075KI59 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A075KI59
DOMAINcd43/230TSTGPGEGKSTTTANTAVALAQSGKQVILVDCDLRKPVQHKIFGKKNRGLTNILVEEVMA
DTYIQDTQVENLRLLSSGPIPPNPSELLGSIKMLELIDYLKNQADYVIIDAPPVIAVTDA
SVLASRVDGVTLVINSGFVRPEMAQKAKDLLVKANGHLLGVILNRVEIEEEHAYYYYYYG
SDSKKIAK
SITEWalker A50/52GKS
SITEWalker A'70/77ILVDCDLR
SITEWalker B149/155VIIDAPP
SITEY Cluster216/221YYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTTTRKLIVHEDAKSPVAEAYRTLRTNIQFSKTDGELKSIMFTSTGPGEGKSTTTANTAVALAQSGKQVILVDCDLRKPV
                                          TSTGPGEGKSTTTANTAVALAQSGKQVILVDCDLRKPV
                                                 GKS                 ILVDCDLR   
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QHKIFGKKNRGLTNILVEEVMADTYIQDTQVENLRLLSSGPIPPNPSELLGSIKMLELIDYLKNQADYVIIDAPPVIAVT
QHKIFGKKNRGLTNILVEEVMADTYIQDTQVENLRLLSSGPIPPNPSELLGSIKMLELIDYLKNQADYVIIDAPPVIAVT
                                                                    VIIDAPP     
       170       180       190       200       210       220       230
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DASVLASRVDGVTLVINSGFVRPEMAQKAKDLLVKANGHLLGVILNRVEIEEEHAYYYYYYGSDSKKIAK
DASVLASRVDGVTLVINSGFVRPEMAQKAKDLLVKANGHLLGVILNRVEIEEEHAYYYYYYGSDSKKIAK
                                                       YYYYYY         
© 1998-2019