BYKdb

Annotate results for A0A075LU31

A0A075LU31 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A075LU31
DOMAINcd51/230TSSGPSEGKSSTTANLAVVFAQQGKKVLLIDADLRKPTVHYTFKLDNRAGLSTVLVGEKP
LEEATKETDVPNLDILTCGPIPPNPSELLGSNAMKQLIKKAQETYDMVIFDTPPVLAVTD
AQILANTCDGALIVVRSEKTEYDAIQKAKELLEPAHAKLLGIVLNDVAQKKSNTYYYYGS
SITEWalker A58/60GKS
SITEWalker A'78/85LLIDADLR
SITEWalker B158/164VIFDTPP
SITEY Cluster225/228YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAKRKKQFKTNVRSLITKFNPKSPISEQYRTIRTNIEFASVDTAMRSLLITSSGPSEGKSSTTANLAVVFAQQGKKVLLI
                                                  TSSGPSEGKSSTTANLAVVFAQQGKKVLLI
                                                         GKS                 LLI
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DADLRKPTVHYTFKLDNRAGLSTVLVGEKPLEEATKETDVPNLDILTCGPIPPNPSELLGSNAMKQLIKKAQETYDMVIF
DADLRKPTVHYTFKLDNRAGLSTVLVGEKPLEEATKETDVPNLDILTCGPIPPNPSELLGSNAMKQLIKKAQETYDMVIF
DADLR                                                                        VIF
       170       180       190       200       210       220       230
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTPPVLAVTDAQILANTCDGALIVVRSEKTEYDAIQKAKELLEPAHAKLLGIVLNDVAQKKSNTYYYYGS
DTPPVLAVTDAQILANTCDGALIVVRSEKTEYDAIQKAKELLEPAHAKLLGIVLNDVAQKKSNTYYYYGS
DTPP                                                            YYYY  
© 1998-2019