BYKdb

Annotate results for A0A076HBF2

A0A076HBF2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A076HBF2
DOMAINtad37/191DEIDLRELWRALQRRKKLVGVTAGSIIVLAALFTTYQRLFRPVYEGSFSLLITDPISNEG
GGRSGMANVEGTMFEQLARNTTSNDIPTLIEVLQSPVLLQPVADKFELTTDALRSRVDIS
TGGAKRKEAEGVLNVRLTGRNPIEDERLLNALSNT
DOMAINcd562/757TSSLPAEGKSLVNVLLAKTLSEMGQRILLIDADLRKPQMHVRLGLNNLSGLSNVLTEDDQ
TWRDAVQTVPGYQNWSVLTAGRRPPDPTRLLSSNRMRSLVNELEASGQFDLVLFDTPPVL
GLADAALVAEHCDGLMLLVSLDRVDRSLPKESVSRIRSSGAPLLGIVTNALKPEKQSAAY
GYGKYGYGKYGYGKYG
SITEWalker A569/571GKS
SITEWalker A'589/596LLIDADLR
SITEWalker B673/679VLFDTPP
SITEY Cluster741/766YGYGKYGYGKYGYGKYGYGGYGGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSNLVAAPGQSPDFDARNVQTVRVHEVGTNEPIGTEDEIDLRELWRALQRRKKLVGVTAGSIIVLAALFTTYQRLFRPVY
                                    DEIDLRELWRALQRRKKLVGVTAGSIIVLAALFTTYQRLFRPVY

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EGSFSLLITDPISNEGGGRSGMANVEGTMFEQLARNTTSNDIPTLIEVLQSPVLLQPVADKFELTTDALRSRVDISTGGA
EGSFSLLITDPISNEGGGRSGMANVEGTMFEQLARNTTSNDIPTLIEVLQSPVLLQPVADKFELTTDALRSRVDISTGGA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRKEAEGVLNVRLTGRNPIEDERLLNALSNTYLQAALQQRQQRLADGLAFLNKQAPSLQTRLDQLQGELADFRTRYSLLE
KRKEAEGVLNVRLTGRNPIEDERLLNALSNT                                                 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PTAEGGALKKRETAMAAQVLGLEADRNRLLKVRGEIASGTLTARGFQEAIGQNNGGGQANSGLTVSDVDQSLLQQLLKVE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TELAEARSRYNPGSSMVLGLEERLNQLRPLLRQNQLEAADAALSLNAGRLATARMQQATLNQQFLQQPGLIKQYEALQQR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEIAKQNLAGLVSAREKFQLEIAQRSVPWRVIAEPTINPKPIKPSVPRNLALGTVLGLVAGAAAGLLRDRMDHVFHHAGE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VKDDLGLPLLGHIPHVEFFKGVREDKRFLLQELDRSVTGEDDPEAAKQRRYQRFLYQEAFRNLFTSIRFLNSDQPLRSIA


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTSSLPAEGKSLVNVLLAKTLSEMGQRILLIDADLRKPQMHVRLGLNNLSGLSNVLTEDDQTWRDAVQTVPGYQNWSVLT
 TSSLPAEGKSLVNVLLAKTLSEMGQRILLIDADLRKPQMHVRLGLNNLSGLSNVLTEDDQTWRDAVQTVPGYQNWSVLT
        GKS                 LLIDADLR                                            
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGRRPPDPTRLLSSNRMRSLVNELEASGQFDLVLFDTPPVLGLADAALVAEHCDGLMLLVSLDRVDRSLPKESVSRIRSS
AGRRPPDPTRLLSSNRMRSLVNELEASGQFDLVLFDTPPVLGLADAALVAEHCDGLMLLVSLDRVDRSLPKESVSRIRSS
                                VLFDTPP                                         
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GAPLLGIVTNALKPEKQSAAYGYGKYGYGKYGYGKYGYGGYGGYGYGGYGYAAYDTSAAYAYYANDEDDTQSSDNGDSPA
GAPLLGIVTNALKPEKQSAAYGYGKYGYGKYGYGKYG                                           
                    YGYGKYGYGKYGYGKYGYGGYGGYGY                                  
       810       820       830       840    
....:....|....:....|....:....|....:....|....
AVTTRKRRSLQPSSNGNGKVNDKAPNLRDRWRAQRQRLMKWLDN


© 1998-2019