BYKdb

Annotate results for A0A076IRY8

A0A076IRY8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A076IRY8
DOMAINcd599/789SSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSHTRLHTKEKGMTSFLAGKA
TTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYDYIFVDNVPVGVV
ADAAITNRIADLTIFVVRVGKLDRRMLPEVEKIYRSGQLNNMSLVLNGAIVKTGGYGGYG
YGYGYGYGYVD
SITEWalker A606/608GKT
SITEWalker A'626/633ILIDMDIR
SITEWalker B708/714IFVDNVP
SITE-705/-707YDY
SITEY Cluster774/787YGGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLSKWYWFVLSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRILNRKQV


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLSDFSTDATSITLTANLGDTIQSPVGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QYSSTTQELELQARMARYIKSYLVDPSKETELIPSNTGIADINIETQITAYNANKLKRDKLIEGSSDKNPIVQELNKNLI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALSQATTETDA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RVLDPAGGGDAPISPNGRSMIMAGVMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKGKTENKETAH


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
                                      SSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
                                             GKT                 ILIDMDIR       
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TRLHTKEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYDYIFVDNVPVGVVAD
TRLHTKEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYDYIFVDNVPVGVVAD
                                                                   IFVDNVP      
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAITNRIADLTIFVVRVGKLDRRMLPEVEKIYRSGQLNNMSLVLNGAIVKTGGYGGYGYGYGYGYGYVDGSESCWKRLFR
AAITNRIADLTIFVVRVGKLDRRMLPEVEKIYRSGQLNNMSLVLNGAIVKTGGYGGYGYGYGYGYGYVD           
                                                     YGGYGYGYGYGYGY             
   
...
KKS


© 1998-2019