BYKdb

Annotate results for A0A077MB29

A0A077MB29 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A077MB29
DOMAINtad1/135MELRDYLRIARLHYKAILTFIALGLLTAWLVTLFTPRVYAATASGMVRSGVAESPAEESL
GDTLAKSRAVAYVDVAKSRPVAQKAIDKLGLDTTPDALISHITVTQPVQTATIKVQARAG
SPSGAQQLADTWVVA
DOMAINcd274/463TSPLPGDGKSTVSANLAIALAEAGESVILLDGDLRHPVVAESFGLLEGAGLTDLLTGKAT
LDEVAQHPAQTPNLTVVGAGSIPPNPSELLGSNVMRQLLQTLRRNHMIIVDAPPLLPVTD
AAVLTANADGALVVITAGKTLDTQLDGALTSLEQVNGHVLGVIFNRIESGFASGYGNYGG
YGYYGSYYGH
SITE-411/-413GKT
SITEWalker A'301/308ILLDGDLR
SITEWalker B381/387IIVDAPP
SITEY Cluster448/461YGNYGGYGYYGSYY
SITEWalker A281/283GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELRDYLRIARLHYKAILTFIALGLLTAWLVTLFTPRVYAATASGMVRSGVAESPAEESLGDTLAKSRAVAYVDVAKSRP
MELRDYLRIARLHYKAILTFIALGLLTAWLVTLFTPRVYAATASGMVRSGVAESPAEESLGDTLAKSRAVAYVDVAKSRP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAQKAIDKLGLDTTPDALISHITVTQPVQTATIKVQARAGSPSGAQQLADTWVVALTEQIKELEDPAGKGSSIRMIPVEN
VAQKAIDKLGLDTTPDALISHITVTQPVQTATIKVQARAGSPSGAQQLADTWVVA                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AALPGGPVSPNPVRNLALGFLLGGLAGSAYALLRSRIDRRIRDVDTVTRQFGVTVAGAIPASEILRRNEEGHVPVVFGGR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GDSKRSQVVESFLKIRTNLQFMDIDNPPRVIVVTSPLPGDGKSTVSANLAIALAEAGESVILLDGDLRHPVVAESFGLLE
                                 TSPLPGDGKSTVSANLAIALAEAGESVILLDGDLRHPVVAESFGLLE
                                        GKS                 ILLDGDLR            
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GAGLTDLLTGKATLDEVAQHPAQTPNLTVVGAGSIPPNPSELLGSNVMRQLLQTLRRNHMIIVDAPPLLPVTDAAVLTAN
GAGLTDLLTGKATLDEVAQHPAQTPNLTVVGAGSIPPNPSELLGSNVMRQLLQTLRRNHMIIVDAPPLLPVTDAAVLTAN
                                                            IIVDAPP             
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADGALVVITAGKTLDTQLDGALTSLEQVNGHVLGVIFNRIESGFASGYGNYGGYGYYGSYYGHDEAKGKGKEAKAPAAPT
ADGALVVITAGKTLDTQLDGALTSLEQVNGHVLGVIFNRIESGFASGYGNYGGYGYYGSYYGH                 
                                               YGNYGGYGYYGSYY                   
       490       500       510       520       530
....:....|....:....|....:....|....:....|....:....|
PDGYDGPPPVARFPAPAPPPPGSLADRIDAGDVDTPAPAGATASDARPAD


© 1998-2019