BYKdb

Annotate results for A0A078M2N2

A0A078M2N2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A078M2N2
DOMAINcd53/235TSATPNAGKSTVAANVAVAYAQAGKNTLLIDGDLRRPTTHYTFEMQNVRGLSTAIINELP
LNEVTRESGIENLDVITSGPIPPNPSELLSSKKMNLFMKMVTDHYDMVIIDSPPALAVTD
SQVLSQLTDATILVTNVDDNNRDSILQAKELMEKADANIIGVVLNNKKMDNKKDSYYYYY
GSE
SITEWalker A60/62GKS
SITEWalker A'80/87LLIDGDLR
SITEWalker B160/166VIIDSPP
SITEY Cluster228/232YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFGKKNHRKFQSGPRELVVDRKPKSPVSEHFRTIRTNITYSNIDNPVKSVLFTSATPNAGKSTVAANVAVAYAQAGKNTL
                                                    TSATPNAGKSTVAANVAVAYAQAGKNTL
                                                           GKS                 L
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIDGDLRRPTTHYTFEMQNVRGLSTAIINELPLNEVTRESGIENLDVITSGPIPPNPSELLSSKKMNLFMKMVTDHYDMV
LIDGDLRRPTTHYTFEMQNVRGLSTAIINELPLNEVTRESGIENLDVITSGPIPPNPSELLSSKKMNLFMKMVTDHYDMV
LIDGDLR                                                                        V
       170       180       190       200       210       220       230     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
IIDSPPALAVTDSQVLSQLTDATILVTNVDDNNRDSILQAKELMEKADANIIGVVLNNKKMDNKKDSYYYYYGSE
IIDSPPALAVTDSQVLSQLTDATILVTNVDDNNRDSILQAKELMEKADANIIGVVLNNKKMDNKKDSYYYYYGSE
IIDSPP                                                             YYYYY   
© 1998-2019