BYKdb

Annotate results for A0A078PL82

A0A078PL82 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A078PL82
DOMAINcd587/776ASFNMGAGKTFVSVNLAASLVQAEKKIIMIDLDLRKGRLSHFAHAKRVKGVAHYLSNPLV
SADDIILHDAFGEGLDLIPIGVIAPNPTELLLNRRLDELIVKLRRRYDYIIVDNVPIGVV
ADASVVNRISDLTLFIVRVGKLDRRQLPELERLYQEHRLNNLAVVLNGAKKGSRGYGYGY
GYGYGIDVEK
SITEWalker A594/596GKT
SITEWalker A'614/621IMIDLDLR
SITEWalker B696/702IIVDNVP
SITE-693/-695YDY
SITEY Cluster762/770YGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEKQRKLALTEEEKSVNIVDVFMYLIAHWKWYFLSILLFGGCFWYFYCKTPFVYSRVAIVMIKTPTNSRSAMQLYGSNDF


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGQINVASEILQFKSKELMRKVIDRLQANVSYMVYDGLRPRELYTEAPIRVAFMDAIPGERCFLSVIPKNQQQVELAEFS


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KGTELRRVVNLNDTVHTALGKLVVFAAENYGGDWMERAVKVISHPQEDMVSFWLSNLTIRQMSGDAALLRITMDDWSPVR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDINTVAGIYIQDSRQYELLIK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELDTQLQLVTFIRQYLQDSGKEEELIPGNIGLTDINIESQIARYNETLLRRNRLVSGSSSNNPVVQELDRSMQTMRQNIF


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RALDNLSASLKQKKNDYTVQENRVRQKVQAVPRKQREMLSVERQQKVKESLYVFLLNKREENALNQAMVDNNARILDPVS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GSNIPISPNKYNKVLLGAGCGVIVPTVVLLLILVLDTRVHSRKEIEASVSAPFLADIPQVSKTEADAQEVMVRARGLDPL


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SEAFRILRTNLGFMISQPQEQKVITLASFNMGAGKTFVSVNLAASLVQAEKKIIMIDLDLRKGRLSHFAHAKRVKGVAHY
                          ASFNMGAGKTFVSVNLAASLVQAEKKIIMIDLDLRKGRLSHFAHAKRVKGVAHY
                                 GKT                 IMIDLDLR                   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSNPLVSADDIILHDAFGEGLDLIPIGVIAPNPTELLLNRRLDELIVKLRRRYDYIIVDNVPIGVVADASVVNRISDLTL
LSNPLVSADDIILHDAFGEGLDLIPIGVIAPNPTELLLNRRLDELIVKLRRRYDYIIVDNVPIGVVADASVVNRISDLTL
                                                       IIVDNVP                  
       730       740       750       760       770       780         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
FIVRVGKLDRRQLPELERLYQEHRLNNLAVVLNGAKKGSRGYGYGYGYGYGIDVEKSGWWSRMKKRMKR
FIVRVGKLDRRQLPELERLYQEHRLNNLAVVLNGAKKGSRGYGYGYGYGYGIDVEK             
                                         YGYGYGYGY                   

© 1998-2019