BYKdb

Annotate results for A0A078T2W6

A0A078T2W6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A078T2W6
DOMAINtad15/260DFLRIQDLLYLCLARWKWFVLSLMVTIGVATVYLLRTPAVYTRTASVLIKEDSKGKSVSS
DLESFSEFGLFQSGTNVNNELITFQSPALMTEVVKRLRLDMNYFVPGKFHRQVAYGLTLP
VDVTINDLPENESAGFTLKIQPDGTLYLSDFIRNGTDLDEKDVKGSLLDSITTPLGKIII
HTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVIDLSFKDNSTQRAEDVL
SMLISV
DOMAINcd603/793TSFNPGSGKSFLTMNIAMSLAIKGKKVLVIDGDLRHASASSYIDSPDKGLSDYLGGRIDN
LDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVELVA
DTQIIEKLADRTIFVVRAGLLERSMLSELEKIYDEKKYKNMSLILNGTEGSGGRYGYCYG
YRYGYGSGYHY
SITEWalker A610/612GKS
SITEWalker A'630/637LVIDGDLR
SITEWalker B711/717VLIDCPP
SITE-708/-710YDY
SITEY Cluster755/793YDEKKYKNMSLILNGTEGSGGRYGYCYGYRYGYGSGYHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAINQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLMVTIGVATVYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
              DFLRIQDLLYLCLARWKWFVLSLMVTIGVATVYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EFGLFQSGTNVNNELITFQSPALMTEVVKRLRLDMNYFVPGKFHRQVAYGLTLPVDVTINDLPENESAGFTLKIQPDGTL
EFGLFQSGTNVNNELITFQSPALMTEVVKRLRLDMNYFVPGKFHRQVAYGLTLPVDVTINDLPENESAGFTLKIQPDGTL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YLSDFIRNGTDLDEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVIDL
YLSDFIRNGTDLDEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVIDL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SFKDNSTQRAEDVLSMLISV                                                            

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSEANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPVVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKKP


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QEVKAVVVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAMSLAIKGKKVLVIDGDLRHAS
                                          TSFNPGSGKSFLTMNIAMSLAIKGKKVLVIDGDLRHAS
                                                 GKS                 LVIDGDLR   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
                                                                      VLIDCPP   
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VADTQIIEKLADRTIFVVRAGLLERSMLSELEKIYDEKKYKNMSLILNGTEGSGGRYGYCYGYRYGYGSGYHYGSDGKRG
VADTQIIEKLADRTIFVVRAGLLERSMLSELEKIYDEKKYKNMSLILNGTEGSGGRYGYCYGYRYGYGSGYHY       
                                  YDEKKYKNMSLILNGTEGSGGRYGYCYGYRYGYGSGYHY       
  
..
WR


© 1998-2019