BYKdb

Annotate results for A0A080UG06

A0A080UG06 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A080UG06
DOMAINcd52/231TSAGPGEGKSTTAANLAVVFAQQGKKVLLVDADLRKPTVHFTFRLDNADGLTSILLKQIS
FEQAVHPSEENNLDILTSGPIPPNPAELLSSKGMEDLLENIYECYDMVIFDTPPLLAVAD
PQILGNYVDGSIMVVSSGKTDKEKAAKAKEVLATCKSKLLGAVMNGKKITKNSYYAYYGN
SITE-189/-191GKT
SITEWalker A'79/86LLVDADLR
SITEWalker B159/165VIFDTPP
SITE-153/-156YECY
SITEY Cluster225/229YYAYY
SITEWalker A59/61GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARKKTLRSLMSIRNIITMTEPKSLNSEQYRTIRTNIEYSSIDSQVKSLIITSAGPGEGKSTTAANLAVVFAQQGKKVLL
                                                   TSAGPGEGKSTTAANLAVVFAQQGKKVLL
                                                          GKS                 LL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDADLRKPTVHFTFRLDNADGLTSILLKQISFEQAVHPSEENNLDILTSGPIPPNPAELLSSKGMEDLLENIYECYDMVI
VDADLRKPTVHFTFRLDNADGLTSILLKQISFEQAVHPSEENNLDILTSGPIPPNPAELLSSKGMEDLLENIYECYDMVI
VDADLR                                                                        VI
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
FDTPPLLAVADPQILGNYVDGSIMVVSSGKTDKEKAAKAKEVLATCKSKLLGAVMNGKKITKNSYYAYYGN
FDTPPLLAVADPQILGNYVDGSIMVVSSGKTDKEKAAKAKEVLATCKSKLLGAVMNGKKITKNSYYAYYGN
FDTPP                                                           YYAYY  
© 1998-2019