BYKdb

Annotate results for A0A081BI99

A0A081BI99 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A081BI99
DOMAINcd57/245TSSDPSEGKSTVSMNLAAVWAQQGQKVLVLDADLRRPTVHRTFSLSNRAGLSTYLSHLAS
YEDIIQESGMENLSVITSGPIPPNPAELLNSKGLSDLLEQLKANFDVVILDAPPVNTVTD
AQLLAHKTDGVILVVPQGIAEKSSVAHAVDMLKKVHANILGTVMNRFQSSKAAGYYGGYY
GGYYGVDEK
SITEWalker A64/66GKS
SITEWalker A'84/91LVLDADLR
SITEWalker B164/170VILDAPP
SITEY Cluster231/240YYGGYYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPLFRRKRKINNDSLKNGVGLVAIDDSKSIVAEQFRTVRTNIQFSSVDEQVQTLLITSSDPSEGKSTVSMNLAAVWAQQG
                                                        TSSDPSEGKSTVSMNLAAVWAQQG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QKVLVLDADLRRPTVHRTFSLSNRAGLSTYLSHLASYEDIIQESGMENLSVITSGPIPPNPAELLNSKGLSDLLEQLKAN
QKVLVLDADLRRPTVHRTFSLSNRAGLSTYLSHLASYEDIIQESGMENLSVITSGPIPPNPAELLNSKGLSDLLEQLKAN
   LVLDADLR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FDVVILDAPPVNTVTDAQLLAHKTDGVILVVPQGIAEKSSVAHAVDMLKKVHANILGTVMNRFQSSKAAGYYGGYYGGYY
FDVVILDAPPVNTVTDAQLLAHKTDGVILVVPQGIAEKSSVAHAVDMLKKVHANILGTVMNRFQSSKAAGYYGGYYGGYY
   VILDAPP                                                            YYGGYYGGYY
       
....:..
GVDEKND
GVDEK  

© 1998-2019