BYKdb

Annotate results for A0A081BXV5

A0A081BXV5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A081BXV5
DOMAINtad4/185EVIQLREYVHILKKRRWIILTVTFLTVVAITIWTFRQIPIYEATTRILIEKESPNLIAFE
EVLKLDTSAQDYYQTQYMILMSRSLAKEVLKKLGLTDLQRPQVQMFFSVRGIFNELAEKL
GLSTPAPSPESDETIDKEERLVNEFLQSITVSPIRGSRLVDIKAISTDRQQAAMLANTLA
DV
DOMAINcd543/733TSPGPAEGKSCIVANLGIAMAQSGSKTLIIDCDLRKPVMHKIFNVNNDRGFADMMADIKT
YGTKVVVKHTKIKNLDVIPCGKIPPNPSELLGSSLARIVIEALAERYDKILIDSPPVNTV
TDPILLSRIADGIVFIVHAGQTKRDVAQRARDQLLSADAVILGGVINSVDLKKDSYYYYY
SYYHSHYYTQD
SITEWalker A550/552GKS
SITEWalker A'570/577LIIDCDLR
SITEWalker B652/658ILIDSPP
SITEY Cluster718/730YYYYYSYYHSHYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFDEVIQLREYVHILKKRRWIILTVTFLTVVAITIWTFRQIPIYEATTRILIEKESPNLIAFEEVLKLDTSAQDYYQTQY
   EVIQLREYVHILKKRRWIILTVTFLTVVAITIWTFRQIPIYEATTRILIEKESPNLIAFEEVLKLDTSAQDYYQTQY

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MILMSRSLAKEVLKKLGLTDLQRPQVQMFFSVRGIFNELAEKLGLSTPAPSPESDETIDKEERLVNEFLQSITVSPIRGS
MILMSRSLAKEVLKKLGLTDLQRPQVQMFFSVRGIFNELAEKLGLSTPAPSPESDETIDKEERLVNEFLQSITVSPIRGS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLVDIKAISTDRQQAAMLANTLADVYIERNLDDKLVASKDAVLWLEKEVEITQKKVADSEAALQQYKEEHGILSFEERQN
RLVDIKAISTDRQQAAMLANTLADV                                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IIMQKLLELNTAVNEAKIKRAAIEAQYKQVQKYQSDKVESLSVVINNPLIQGLKVELANLESELSQLRKKFRDKHPNMTA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQSQIDATKSRLNTEIKRIFDSLKSDYEVALAQEKDLSKMLEEQKHEAMDLNKKAIRYGELQREVESNHRVYNELLQRTK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ETNVTERLQTNNIRIVDHAVVPNSPIAPKKIRNILLAMVVGLTMGIGLAFFFEFWDNSIKTSDDIKQYLDMPFLGFIPKV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YGKEYSNNGNNGTRAKPDMIVAIDPKSSASEAYRTLRTNVVFSLVSDEERALDLDFGSVMLVTSPGPAEGKSCIVANLGI
                                                              TSPGPAEGKSCIVANLGI
                                                                     GKS        
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AMAQSGSKTLIIDCDLRKPVMHKIFNVNNDRGFADMMADIKTYGTKVVVKHTKIKNLDVIPCGKIPPNPSELLGSSLARI
AMAQSGSKTLIIDCDLRKPVMHKIFNVNNDRGFADMMADIKTYGTKVVVKHTKIKNLDVIPCGKIPPNPSELLGSSLARI
         LIIDCDLR                                                               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VIEALAERYDKILIDSPPVNTVTDPILLSRIADGIVFIVHAGQTKRDVAQRARDQLLSADAVILGGVINSVDLKKDSYYY
VIEALAERYDKILIDSPPVNTVTDPILLSRIADGIVFIVHAGQTKRDVAQRARDQLLSADAVILGGVINSVDLKKDSYYY
           ILIDSPP                                                           YYY
       730       740  
....:....|....:....|..
YYSYYHSHYYTQDGKKQLNAAA
YYSYYHSHYYTQD         
YYSYYHSHYY            

© 1998-2019