BYKdb

Annotate results for A0A081C5E2

A0A081C5E2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A081C5E2
DOMAINcd51/237TSCIPREGKSTTVANLGVTFALAQQKVLIIDADLRRPILHRLFGIPNVQGLTHTLSDTVE
YDQVFTPTKISNLWVVTSGIIPPNPSELLGSKKMKAFLERAKQQFDMILLDSPPISSLAD
ASVLGSIVDGVLFIVKVNMANRDLIQKAKEQLTTVGANIIGVVLNDVDVKRDGYYKYYYY
YNYEYYG
SITEWalker A58/60GKS
SITEWalker A'78/85LIIDADLR
SITEWalker B158/164ILLDSPP
SITEY Cluster224/236YYKYYYYYNYEYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARHRSSRKHRDLNIIWEEGKHSMAAESYRTLRTNISLSQVDNPIRTLLVTSCIPREGKSTTVANLGVTFALAQQKVLII
                                                  TSCIPREGKSTTVANLGVTFALAQQKVLII
                                                         GKS                 LII
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DADLRRPILHRLFGIPNVQGLTHTLSDTVEYDQVFTPTKISNLWVVTSGIIPPNPSELLGSKKMKAFLERAKQQFDMILL
DADLRRPILHRLFGIPNVQGLTHTLSDTVEYDQVFTPTKISNLWVVTSGIIPPNPSELLGSKKMKAFLERAKQQFDMILL
DADLR                                                                        ILL
       170       180       190       200       210       220       230       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
DSPPISSLADASVLGSIVDGVLFIVKVNMANRDLIQKAKEQLTTVGANIIGVVLNDVDVKRDGYYKYYYYYNYEYYG
DSPPISSLADASVLGSIVDGVLFIVKVNMANRDLIQKAKEQLTTVGANIIGVVLNDVDVKRDGYYKYYYYYNYEYYG
DSPP                                                           YYKYYYYYNYEYY 
© 1998-2019