BYKdb

Annotate results for A0A081GP61

A0A081GP61 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A081GP61
DOMAINcd543/736TSSTQGEGKSTAVTVFASTLADLGLKVLIIDSDMRLPMQTRYLGVEPGDGFSTLLSDSSR
KTTDLIQTIAENMDVLPAGPKPPDPAKLLNSSRCKEIMDEIRALPGYDIIIVDAPPCLML
ADPILLGEKLDGILFLVGLGKVSRELAPQASRRIKATGVDVLGIICNQVNFPSRLNDYGY
EYGYYYHYAYASAS
SITEWalker A550/552GKS
SITEWalker A'570/577LIIDSDMR
SITEWalker B652/658IIVDAPP
SITEY Cluster720/738YGYEYGYYYHYAYASASGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGGFPPSGAAGRFQAPYPDQPLQSPLTPTAEAQAGSGGLGGLVRTIRRRQTVFLLTFAVVTGALAINTLRQRIFSPVYQG


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GFQMQISNPFEDKNGGGGGGSVEAIARTPLKPDVPSLIVLMRSPLLLGPVAQRQGVPLDLLAANLSINPESAAVENVLNI


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLRWPDPVKGKAILRQLAKDYTAFSLTQRQAAVNSGVRFLDQQAPAIEARVQKLSNEMLRFRERNNFVDPATAAGQILGA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDGLVNQLRDLQNEQVQLDSQLQSIQSGKLQFSSSGAPTAIQQLGRNSVLVPGRANQNQGAEVAKGTPTPLDLLNQFEQE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LATAKGTYKQNSPIVQSLLARRNQLLPVVQRQASDAVKARLLSNLAQQDEINRQILLLNQNFRNNPQKLSEFENINQRLS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IAREQYSSYIQARERYRLEMARSITPWEVIGPPDFGASPVEPDIQRNLLRAIMIGLLAGLGAAILRERTDNVFHTPMEVE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KELQLPVLGLIPYLPLEPGVDIATSISKMSSSERFAIKESLRSLFTTFRLLRADNNIRMVGITSSTQGEGKSTAVTVFAS
                                                              TSSTQGEGKSTAVTVFAS
                                                                     GKS        
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLADLGLKVLIIDSDMRLPMQTRYLGVEPGDGFSTLLSDSSRKTTDLIQTIAENMDVLPAGPKPPDPAKLLNSSRCKEIM
TLADLGLKVLIIDSDMRLPMQTRYLGVEPGDGFSTLLSDSSRKTTDLIQTIAENMDVLPAGPKPPDPAKLLNSSRCKEIM
         LIIDSDMR                                                               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DEIRALPGYDIIIVDAPPCLMLADPILLGEKLDGILFLVGLGKVSRELAPQASRRIKATGVDVLGIICNQVNFPSRLNDY
DEIRALPGYDIIIVDAPPCLMLADPILLGEKLDGILFLVGLGKVSRELAPQASRRIKATGVDVLGIICNQVNFPSRLNDY
           IIVDAPP                                                             Y
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GYEYGYYYHYAYASASGYAKSANQGKSYGGFGSYVQRYRDSYMKGAPSNAYFNAHQQNGDLDVRSYYQQEDGSGASAATR
GYEYGYYYHYAYASAS                                                                
GYEYGYYYHYAYASASGY                                                              
       810       820       830       840       850       
....:....|....:....|....:....|....:....|....:....|....:..
PPSEDSKGSGVSIRSSLPDSGRESTGSHAGDSQGVRKGASQGPIGWLRQRFGRGSQR


© 1998-2019