BYKdb

Annotate results for A0A081M9G7

A0A081M9G7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A081M9G7
DOMAINtad1/165MGIFRRQILLILSLVVGLTAVAAIIVYSIEPRYSASALVFVDTSSKDILEADPRSQNGST
DNARVESEVAIVSSDGVLLDVINSQNLVADEEFGVKVGLIDRFLEMIRLKTAEPPNPAEA
VSGVLNNFREAVSVNRRGLTYLINISVTSKSREKAALLANAVAQT
DOMAINcd511/699SSALPNEGKSTIALSLARTYALSGKRTLIIDCDLRKPSLHRHLGLAPDTTLVTYLQGGDA
GSLPKLTTADPSTGLTVVLGGRRGNSPTDQLLMGQEMARLISVARRNFDYIILDTPPIEP
VVDGLYLARHADVIAFVVKWAATSQSSAKHAVAALRDSAPDGTPLLAVLNQQERAKLLGY
SSYSDYYVE
SITEWalker A518/520GKS
SITEWalker A'538/545LIIDCDLR
SITEWalker B621/627IILDTPP
SITEY Cluster690/697YSSYSDYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGIFRRQILLILSLVVGLTAVAAIIVYSIEPRYSASALVFVDTSSKDILEADPRSQNGSTDNARVESEVAIVSSDGVLLD
MGIFRRQILLILSLVVGLTAVAAIIVYSIEPRYSASALVFVDTSSKDILEADPRSQNGSTDNARVESEVAIVSSDGVLLD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VINSQNLVADEEFGVKVGLIDRFLEMIRLKTAEPPNPAEAVSGVLNNFREAVSVNRRGLTYLINISVTSKSREKAALLAN
VINSQNLVADEEFGVKVGLIDRFLEMIRLKTAEPPNPAEAVSGVLNNFREAVSVNRRGLTYLINISVTSKSREKAALLAN

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVAQTYIRRQVESKVSATLASRDILQKQVENARANIAGSARSVDDFILGNINTLREQGSSNVGLLYDELTRIQQERRDGL
AVAQT                                                                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKVETIDDTLKRNDLATLVQSLETQAAEELERQRQALAGQLASASPAAAIDLRAELQRLDETIAEEGRRTLNSLRSEVQN


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FEQEELSVRSSLTDAVLTSNLPNETLTQLYSLRQTAEGARREFDNLSSRLQRLDTQAALQMADSRVVSEALAPRDASFPK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KKLILPLAAVMALGLGVGLAFVREYFVGGFTNEDQVATVLRLPLASISPRATEEPGRDDADGHSLSDIIIRSPLSMFSES


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRRIRVAVDQCLYKKNGQRDESSGGTVVMISSALPNEGKSTIALSLARTYALSGKRTLIIDCDLRKPSLHRHLGLAPDTT
                              SSALPNEGKSTIALSLARTYALSGKRTLIIDCDLRKPSLHRHLGLAPDTT
                                     GKS                 LIIDCDLR               
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVTYLQGGDAGSLPKLTTADPSTGLTVVLGGRRGNSPTDQLLMGQEMARLISVARRNFDYIILDTPPIEPVVDGLYLARH
LVTYLQGGDAGSLPKLTTADPSTGLTVVLGGRRGNSPTDQLLMGQEMARLISVARRNFDYIILDTPPIEPVVDGLYLARH
                                                            IILDTPP             
       650       660       670       680       690         
....:....|....:....|....:....|....:....|....:....|....:....
ADVIAFVVKWAATSQSSAKHAVAALRDSAPDGTPLLAVLNQQERAKLLGYSSYSDYYVE
ADVIAFVVKWAATSQSSAKHAVAALRDSAPDGTPLLAVLNQQERAKLLGYSSYSDYYVE
                                                 YSSYSDYY  
© 1998-2019