BYKdb

Annotate results for A0A081NZL5

A0A081NZL5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A081NZL5
DOMAINcd46/226TSSSPMEGKSTTINNLAVVYAQSNRKVLLIDADLRKPTAHHTFHLSNRYGLTDVLTSQCT
LEMAVKVTDIPNLEVMTSGSIPPNPSEILASQKMTGLLEELQQRYDIVLLDTPPVLAVSD
AQIIATKCDGVILVVDSGKVKRDLVQKAKNSLEFVQANLLGVVLNRIARPSGNAYYYYGN
E
SITEWalker A53/55GKS
SITEWalker A'73/80LLIDADLR
SITEWalker B153/159VLLDTPP
SITEY Cluster220/223YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSKSAKRRPVIAHSHPKSPVSESYRTLRTNIQFSSVDRLCRTLMVTSSSPMEGKSTTINNLAVVYAQSNRKVLLIDADLR
                                             TSSSPMEGKSTTINNLAVVYAQSNRKVLLIDADLR
                                                    GKS                 LLIDADLR
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPTAHHTFHLSNRYGLTDVLTSQCTLEMAVKVTDIPNLEVMTSGSIPPNPSEILASQKMTGLLEELQQRYDIVLLDTPPV
KPTAHHTFHLSNRYGLTDVLTSQCTLEMAVKVTDIPNLEVMTSGSIPPNPSEILASQKMTGLLEELQQRYDIVLLDTPPV
                                                                        VLLDTPP 
       170       180       190       200       210       220      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
LAVSDAQIIATKCDGVILVVDSGKVKRDLVQKAKNSLEFVQANLLGVVLNRIARPSGNAYYYYGNE
LAVSDAQIIATKCDGVILVVDSGKVKRDLVQKAKNSLEFVQANLLGVVLNRIARPSGNAYYYYGNE
                                                           YYYY   
© 1998-2019