BYKdb

Annotate results for A0A081QKT4

A0A081QKT4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A081QKT4
DOMAINcd41/227TSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMSGVFKSREKITGLTEFLSGTT
DLSHGLCDTNVENLFVVQAGSISPNPTALLQSENFSTMIDTLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASVLVTAAGEANRKDVQKAKGQLEQTNKPFLGVVLNKFNTSAEKYGSYGE
YGSYGKK
SITEWalker A48/50GKS
SITEWalker A'68/75LLVDADIR
SITEWalker B149/155IIVDTAP
SITE-145/-148YFDY
SITEY Cluster215/224YGSYGEYGSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPTLEIAQKKLDLAKKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
                                        TSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
                                               GKS                 LLVDADIR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVFKSREKITGLTEFLSGTTDLSHGLCDTNVENLFVVQAGSISPNPTALLQSENFSTMIDTLRKYFDYIIVDTAPIGIVI
GVFKSREKITGLTEFLSGTTDLSHGLCDTNVENLFVVQAGSISPNPTALLQSENFSTMIDTLRKYFDYIIVDTAPIGIVI
                                                                    IIVDTAP     
       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
DAAIITQKCDASVLVTAAGEANRKDVQKAKGQLEQTNKPFLGVVLNKFNTSAEKYGSYGEYGSYGKK
DAAIITQKCDASVLVTAAGEANRKDVQKAKGQLEQTNKPFLGVVLNKFNTSAEKYGSYGEYGSYGKK
                                                      YGSYGEYGSY   
© 1998-2019