BYKdb

Annotate results for A0A083X494

A0A083X494 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A083X494
DOMAINtad11/154NGVTILDLFNAVRKHVITAVVTLVIVMVAICAYTFTRTPQYTATSELLATYRSSAAASGA
SSNAVELSSGANYINSQIQTYPQLIKTESVLQPVIDDLGLDTTVKELAASVTASNPDGTM
LVDISVNDPDPKQASSIANSVAEN
DOMAINcd289/477TSTGPSEGKTTLSVNLATAFAENGSKVLLIDADVRNPSVSKALGIEGAVGLTHLITNRVS
SHDAIQRYWKPNFHVLPAGKQTMNPSILLNSRAMKALVEQVAEAYDYVIIDTAPMQVAND
AAVFAKEGPELLLVAGLGVTEKKLLRQTGRELSTLSIDPVGLVMNYGEMEKPQKGGYYYY
GDESDDNGR
SITEWalker A296/298GKT
SITEWalker A'316/323LLIDADVR
SITEWalker B396/402VIIDTAP
SITE-393/-395YDY
SITEY Cluster465/468YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDEAEQVQDGNGVTILDLFNAVRKHVITAVVTLVIVMVAICAYTFTRTPQYTATSELLATYRSSAAASGASSNAVELSSG
          NGVTILDLFNAVRKHVITAVVTLVIVMVAICAYTFTRTPQYTATSELLATYRSSAAASGASSNAVELSSG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANYINSQIQTYPQLIKTESVLQPVIDDLGLDTTVKELAASVTASNPDGTMLVDISVNDPDPKQASSIANSVAENLRKQVT
ANYINSQIQTYPQLIKTESVLQPVIDDLGLDTTVKELAASVTASNPDGTMLVDISVNDPDPKQASSIANSVAEN      

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STIYSDEGDKIISPVNLTVVQQAYAPASPSSPNVKLNIAIGLVSGIVLGIVVALIKDLLDTRVRRDSDVTAVIDAPVLGS


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSRNEAYAGTSPVIISRPASREAEEIRRLRTNVMFVLPDEPLSNVIVVTSTGPSEGKTTLSVNLATAFAENGSKVLLIDA
                                                TSTGPSEGKTTLSVNLATAFAENGSKVLLIDA
                                                       GKT                 LLIDA
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DVRNPSVSKALGIEGAVGLTHLITNRVSSHDAIQRYWKPNFHVLPAGKQTMNPSILLNSRAMKALVEQVAEAYDYVIIDT
DVRNPSVSKALGIEGAVGLTHLITNRVSSHDAIQRYWKPNFHVLPAGKQTMNPSILLNSRAMKALVEQVAEAYDYVIIDT
DVR                                                                        VIIDT
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
APMQVANDAAVFAKEGPELLLVAGLGVTEKKLLRQTGRELSTLSIDPVGLVMNYGEMEKPQKGGYYYYGDESDDNGRKRQ
APMQVANDAAVFAKEGPELLLVAGLGVTEKKLLRQTGRELSTLSIDPVGLVMNYGEMEKPQKGGYYYYGDESDDNGR   
AP                                                              YYYY            
       490  
....:....|..
IQHKKSEKMKKD


© 1998-2019