BYKdb

Annotate results for A0A083ZK45

A0A083ZK45 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A083ZK45
DOMAINtad12/196EFIDIDAALAIIRRQWRVVLAAIAVAGAIGLAFAATAVPIYSATATLLIDRNNSQIVEQL
STIGGVVEDEASILSQVEVLQSETIGLAVVDSLKLTENQEFRATRASLLSSIFGTIRSLV
NVSQWFSPTKKEAVIDDGTLKRSLSDRLLNDLSVKRIGRTYALELTYNSTSPVLAAQIVN
AVASA
DOMAINcd554/744VSSLPSEGKSTISINLAQLLAGQGARVLLLDADIRNPGATRAMARHAAEGLLEVLLEGRS
VQDVLLRDEKTYLAFLPTVVKQRVPHSSELLTSAQMHKLLAEASSAFDYIIVDLPPLGPV
VDARAMAGRIDGFIFVTEWGKTARRAVRNTVENEVHIRKKCLGVILNKVDTEKLKLYRAY
GSSEYYHSRYT
SITE-693/-695GKT
SITEWalker A'581/588LLLDADIR
SITEWalker B663/669IIVDLPP
SITEY Cluster730/747YRAYGSSEYYHSRYTRYY
SITEWalker A561/563GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSDYDKSGLTAEFIDIDAALAIIRRQWRVVLAAIAVAGAIGLAFAATAVPIYSATATLLIDRNNSQIVEQLSTIGGVVED
           EFIDIDAALAIIRRQWRVVLAAIAVAGAIGLAFAATAVPIYSATATLLIDRNNSQIVEQLSTIGGVVED

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EASILSQVEVLQSETIGLAVVDSLKLTENQEFRATRASLLSSIFGTIRSLVNVSQWFSPTKKEAVIDDGTLKRSLSDRLL
EASILSQVEVLQSETIGLAVVDSLKLTENQEFRATRASLLSSIFGTIRSLVNVSQWFSPTKKEAVIDDGTLKRSLSDRLL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NDLSVKRIGRTYALELTYNSTSPVLAAQIVNAVASAYLLDKLNSKYEATRRASDWLSDRIAELRQRALDTDLAVQKFRAE
NDLSVKRIGRTYALELTYNSTSPVLAAQIVNAVASA                                            

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HNLITTGNNGLLSDQQLAESNSALILAQSETAKARARVQRIEHILATDDVDAVVTDILDSSVANDLRKKYLESSKLETEI


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TRRLGSSHIQAVRLRNEMQEYRRLMFQEISRIAQSYKSDLEVSEAKEKSLAESVAKATDISNSASETQVQMRELQREAET


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YKNMYQTFLQRYQEAMQQQSFPVTEARVISKAMPPYMPSKPNKPMILVLFMVMGAAAGGGIAIFREFRDRFFRTGDQVRD


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLGLEFLGNTPLIPNQPTTEAQENGHPGLTRPTSVARYAVDHPLSSFAETLRSTRLAIDLGIPAKTGARIVGVVSSLPSE
                                                                         VSSLPSE

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKSTISINLAQLLAGQGARVLLLDADIRNPGATRAMARHAAEGLLEVLLEGRSVQDVLLRDEKTYLAFLPTVVKQRVPHS
GKSTISINLAQLLAGQGARVLLLDADIRNPGATRAMARHAAEGLLEVLLEGRSVQDVLLRDEKTYLAFLPTVVKQRVPHS
GKS                 LLLDADIR                                                    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SELLTSAQMHKLLAEASSAFDYIIVDLPPLGPVVDARAMAGRIDGFIFVTEWGKTARRAVRNTVENEVHIRKKCLGVILN
SELLTSAQMHKLLAEASSAFDYIIVDLPPLGPVVDARAMAGRIDGFIFVTEWGKTARRAVRNTVENEVHIRKKCLGVILN
                      IIVDLPP                                                   
       730       740         
....:....|....:....|....:....
KVDTEKLKLYRAYGSSEYYHSRYTRYYHD
KVDTEKLKLYRAYGSSEYYHSRYT     
         YRAYGSSEYYHSRYTRYY  

© 1998-2019