BYKdb

Annotate results for A0A083ZXQ5

A0A083ZXQ5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A083ZXQ5
DOMAINtad16/253DEIDLGRLIGELIDSRWLIMAVTTAFLILGILYSLFATPIYRADALIQVEQNSGNSLLNN
ISQVLPDSQPDSAPQIELLKSRMILGKTIEDLALTTIVEQQYFPIFGKGFARLTKQVPGN
LVISKFALPSSWSDEPVVTLRVGTDNSYIISRDGEHYANGKVGNLLEKDGFSILISDIQA
APGTEFKITKINELDAITKLLDNYEVADKGKNTGVLGLGLTGADPVLIKNILNTISNN
DOMAINcd538/725SGASPGIGKTFVSANLAAVVAQAGLKVLFIDGDMRKGYVHQLLGLEGGKGLSDLLSGKVS
IASVIQQTTQPGLDFIARGTIPPNPSELLMHKHFSEIINEASGNYDLVLVDTPPILAVTD
AAIIGKLAGAALLVARFEINTPKEVEVSIRRFEQNGVEIKGVILNGVIRKATNYYSYGYD
HYDYSYKS
SITEWalker A545/547GKT
SITEWalker A'565/572LFIDGDMR
SITEWalker B645/651VLVDTPP
SITEY Cluster711/723YYSYGYDHYDYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSEKYKVNNSSNDRSDEIDLGRLIGELIDSRWLIMAVTTAFLILGILYSLFATPIYRADALIQVEQNSGNSLLNNISQVL
               DEIDLGRLIGELIDSRWLIMAVTTAFLILGILYSLFATPIYRADALIQVEQNSGNSLLNNISQVL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PDSQPDSAPQIELLKSRMILGKTIEDLALTTIVEQQYFPIFGKGFARLTKQVPGNLVISKFALPSSWSDEPVVTLRVGTD
PDSQPDSAPQIELLKSRMILGKTIEDLALTTIVEQQYFPIFGKGFARLTKQVPGNLVISKFALPSSWSDEPVVTLRVGTD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NSYIISRDGEHYANGKVGNLLEKDGFSILISDIQAAPGTEFKITKINELDAITKLLDNYEVADKGKNTGVLGLGLTGADP
NSYIISRDGEHYANGKVGNLLEKDGFSILISDIQAAPGTEFKITKINELDAITKLLDNYEVADKGKNTGVLGLGLTGADP

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLIKNILNTISNNYLAQNVARKSAEDEKSLDFLKIQLPKVRSELDAAESKLNQYRQQKDSVDLSLEAKSVLDSIVAVDTQ
VLIKNILNTISNN                                                                   

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNELTFKEAEISKLYTKEHPSYRALLEKRKILETERDKFNKRVNAMPKTQQEILRLSRDVQSGQQVYMQLLNKEQELSIS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KASTIGNVRIIDQAVTQIKPIQPKRLIVILLSMVLGAMLSIGYVLLRSFLHRGIENPEQLEDLGINVYASIPLSEWQQKK


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DIEFQSKNRAKGKKANTDSNSLLSLHNPTDLAIEAIRSLRTSLHFAMIEAKNNIIMISGASPGIGKTFVSANLAAVVAQA
                                                         SGASPGIGKTFVSANLAAVVAQA
                                                                GKT             
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLKVLFIDGDMRKGYVHQLLGLEGGKGLSDLLSGKVSIASVIQQTTQPGLDFIARGTIPPNPSELLMHKHFSEIINEASG
GLKVLFIDGDMRKGYVHQLLGLEGGKGLSDLLSGKVSIASVIQQTTQPGLDFIARGTIPPNPSELLMHKHFSEIINEASG
    LFIDGDMR                                                                    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NYDLVLVDTPPILAVTDAAIIGKLAGAALLVARFEINTPKEVEVSIRRFEQNGVEIKGVILNGVIRKATNYYSYGYDHYD
NYDLVLVDTPPILAVTDAAIIGKLAGAALLVARFEINTPKEVEVSIRRFEQNGVEIKGVILNGVIRKATNYYSYGYDHYD
    VLVDTPP                                                           YYSYGYDHYD
     
....:
YSYKS
YSYKS
YSY  

© 1998-2019