BYKdb

Annotate results for A0A084EL51

A0A084EL51 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A084EL51
DOMAINtad22/191FVESARGTWTVVRRHRVILFVTMALCVLAGVIYILLSTPDYRATASVEVEDVPAGAAGAG
AMQKPVSAADTESMMQTELEVLRSRALAEDVARDLALVGSPVFFQGMDARRPAQGQGSLT
QRQVEHEQVIKLLRDNLQVELPGKSRVLRISFVSADPALSARVANSYADS
DOMAINcd535/714TSAQEEEGKSLTVNALARALARLDKKVLVIDADMRRPVQHSLFRVTATRGISEVLTGQGK
AEDLILDSGVAGVSLLPCGAVPPNPAELLSTPALDALLGAVRDRYDTVLIDAPPILGMSD
AQLLAAKVQVTLLVVEWGRNHHGGLRVAVERLRRAGGSIVGAVLTKAHGRAYDYDYHRGG
SITEWalker A542/544GKS
SITEWalker A'562/569LVIDADMR
SITEWalker B642/648VLIDAPP
SITEY Cluster706/710YDYDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVSRIIELEQRQAGEEDRTTRFVESARGTWTVVRRHRVILFVTMALCVLAGVIYILLSTPDYRATASVEVEDVPAGAAGA
                     FVESARGTWTVVRRHRVILFVTMALCVLAGVIYILLSTPDYRATASVEVEDVPAGAAGA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GAMQKPVSAADTESMMQTELEVLRSRALAEDVARDLALVGSPVFFQGMDARRPAQGQGSLTQRQVEHEQVIKLLRDNLQV
GAMQKPVSAADTESMMQTELEVLRSRALAEDVARDLALVGSPVFFQGMDARRPAQGQGSLTQRQVEHEQVIKLLRDNLQV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELPGKSRVLRISFVSADPALSARVANSYADSLIRADLKRGFESGVQARRFLLGELDGARKDLERAERDLAVYASRTGAVP
ELPGKSRVLRISFVSADPALSARVANSYADS                                                 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEAATDEDKKSDGKDAKPDAAPVPEGSTAARLAQLNAFRAQAVADRIAAQKRWESAKAASAETLPEVLGNGAMQQLMAER


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQARAALVEERQFRKDAHPEMREARARLAALDDQAESMANTIRASLRQEYEVAAHGEKQIASEIAALEGDARVERGRDMQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSMMSRSVETYRLLHDSLLQRYRDMASQAGFQAGRIQPLDRAAVPTTPFAPHAGQIMLVALLGGMLLGLLLIAARHMFDD


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVTSADTLAERVDLPLLGAVPTTGDQPSAPDIFAPIAASLQLASVAGLPRSILVTSAQEEEGKSLTVNALARALARLDKK
                                                      TSAQEEEGKSLTVNALARALARLDKK
                                                             GKS                
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLVIDADMRRPVQHSLFRVTATRGISEVLTGQGKAEDLILDSGVAGVSLLPCGAVPPNPAELLSTPALDALLGAVRDRYD
VLVIDADMRRPVQHSLFRVTATRGISEVLTGQGKAEDLILDSGVAGVSLLPCGAVPPNPAELLSTPALDALLGAVRDRYD
 LVIDADMR                                                                       
       650       660       670       680       690       700       710    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
TVLIDAPPILGMSDAQLLAAKVQVTLLVVEWGRNHHGGLRVAVERLRRAGGSIVGAVLTKAHGRAYDYDYHRGG
TVLIDAPPILGMSDAQLLAAKVQVTLLVVEWGRNHHGGLRVAVERLRRAGGSIVGAVLTKAHGRAYDYDYHRGG
 VLIDAPP                                                         YDYDY    

© 1998-2019