BYKdb

Annotate results for A0A084EW77

A0A084EW77 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A084EW77
DOMAINtad7/242DEIDLVKLLGALLDYKWWIAIFTLLVTLFGVAYVLLATPVYTANASIQVESKSSGGLLKD
FTGILEDKSSSSTEIAILKSRMVLSNTVEQLNLTTVVEPQFSIPFLSKGLHRLMGYEPQL
SVSLFEPKNPQMKEVILEVGENAGEFSLFFADEKVLEGSIGKKYQTEDFSFEISELEAKP
GQLFKIKKNDVLLAISTLQKQISVTESGKQTGIIKISINGENKAQIKKIVKSVSEN
DOMAINcd515/695SGASPSVGKSFISTNLANVLAKAGHKVLLIDADLRRSYLRRLLGLAKEVGLSDVIAQQIP
FEQVIQHYDNFDIIVKGETPPNPSELLSNARFQALLEWAAKEYDLVIVDTAPILAVTDAA
IIGRYAGTSLLVGRFGETTLKEVGLAKERFERAGVFIKGFILNGIKRKASNRYDYYQYDY
K
SITEWalker A522/524GKS
SITEWalker A'542/549LLIDADLR
SITEWalker B620/626VIVDTAP
SITEY Cluster687/694YDYYQYDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNKNNHDEIDLVKLLGALLDYKWWIAIFTLLVTLFGVAYVLLATPVYTANASIQVESKSSGGLLKDFTGILEDKSSSSTE
      DEIDLVKLLGALLDYKWWIAIFTLLVTLFGVAYVLLATPVYTANASIQVESKSSGGLLKDFTGILEDKSSSSTE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IAILKSRMVLSNTVEQLNLTTVVEPQFSIPFLSKGLHRLMGYEPQLSVSLFEPKNPQMKEVILEVGENAGEFSLFFADEK
IAILKSRMVLSNTVEQLNLTTVVEPQFSIPFLSKGLHRLMGYEPQLSVSLFEPKNPQMKEVILEVGENAGEFSLFFADEK

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLEGSIGKKYQTEDFSFEISELEAKPGQLFKIKKNDVLLAISTLQKQISVTESGKQTGIIKISINGENKAQIKKIVKSVS
VLEGSIGKKYQTEDFSFEISELEAKPGQLFKIKKNDVLLAISTLQKQISVTESGKQTGIIKISINGENKAQIKKIVKSVS

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENYLLQNIVRNSAEASKSLEFLSKQLPEIKARLSESENNLNEFRLKNESVDLSLEAKSALDTIVQLEADLNELTLKESEI
EN                                                                              

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SQKFTRNHPAYVALIDKRKVLNEEKIRLNKQVERLPNTQKEVIRLTRDLEVNQQIYIQLLNKMQELEIVKASAIGNVRIL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DEAQVFPNAVSPRKMIVVALAFMLGLIFASITAIAKTLLHRGIEGTSELDVLGLPTYATIPYSNEQPIFSKHKVQRFKLL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SESTPTDPAVEALRSLRTSLHFAMLEAKNNILMISGASPSVGKSFISTNLANVLAKAGHKVLLIDADLRRSYLRRLLGLA
                                  SGASPSVGKSFISTNLANVLAKAGHKVLLIDADLRRSYLRRLLGLA
                                         GKS                 LLIDADLR           
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KEVGLSDVIAQQIPFEQVIQHYDNFDIIVKGETPPNPSELLSNARFQALLEWAAKEYDLVIVDTAPILAVTDAAIIGRYA
KEVGLSDVIAQQIPFEQVIQHYDNFDIIVKGETPPNPSELLSNARFQALLEWAAKEYDLVIVDTAPILAVTDAAIIGRYA
                                                           VIVDTAP              
       650       660       670       680       690     
....:....|....:....|....:....|....:....|....:....|....:
GTSLLVGRFGETTLKEVGLAKERFERAGVFIKGFILNGIKRKASNRYDYYQYDYK
GTSLLVGRFGETTLKEVGLAKERFERAGVFIKGFILNGIKRKASNRYDYYQYDYK
                                              YDYYQYDY 
© 1998-2019