BYKdb

Annotate results for A0A085ETZ4

A0A085ETZ4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A085ETZ4
DOMAINtad4/176QEFGLRNILGTIRRQLGLILAILILVLGVSALLIISLTPMYRATTLVLVDPSEKNLLNPT
NSSSSSASDNARVESEVSIAKSEKTVELVLDALRLTDDPSFQPQPGLRERVATLLRIAPP
ETYTAEELRQVAIGKLQDAITVERQGTTYLITISAYANAPAKAANIANMMAEK
DOMAINcd525/716TSANAGEGKTTAAVSLARSYAISGQSTILIDADLRRPAVHKELGLEPSDALADYLASAGT
PGDDIAPLMLTDGLSKAKFIIGSNIRGAAAGQVVSGERFAKLLNSASRLFDVVIVDTPPV
GALVDALYLAQHVDVIVNVVRFGITSQKEVRATLRELVEAKQDNAEVVALLNAEPQSQAE
TRRRFGSYYVQA
SITEWalker A532/534GKT
SITEWalker A'552/559ILIDADLR
SITEWalker B637/643VIVDTPP
SITEY Cluster712/713YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MHEQEFGLRNILGTIRRQLGLILAILILVLGVSALLIISLTPMYRATTLVLVDPSEKNLLNPTNSSSSSASDNARVESEV
   QEFGLRNILGTIRRQLGLILAILILVLGVSALLIISLTPMYRATTLVLVDPSEKNLLNPTNSSSSSASDNARVESEV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIAKSEKTVELVLDALRLTDDPSFQPQPGLRERVATLLRIAPPETYTAEELRQVAIGKLQDAITVERQGTTYLITISAYA
SIAKSEKTVELVLDALRLTDDPSFQPQPGLRERVATLLRIAPPETYTAEELRQVAIGKLQDAITVERQGTTYLITISAYA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NAPAKAANIANMMAEKYIQSQLQSKINGVLSGRNVMEQRVTETRTGLVAAERSFNDFIISSARTIAEQSGRTDIDQMRIE
NAPAKAANIANMMAEK                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEKIVSDREAASTTLALAETGLSQSNWAQVADTLNTQTLRDLQQRERQIQEELAGVVDGSEQADALRVELVGVLDNFRTQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANAQLEQLRQEIAANRAVETDLQLQLRSNILTSNLPPEVLATMYELQQNAEIARTQYQQMLVRLRDIEAQAYLQLADSRI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSEATPPSGAAFPNTRFLAMVAGILGLMLGLAAAFLREQFIGGIVSTDQLEGIVGPTLVTSLPNQKRLGRSQDGKPVKSL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TELIAAQPYSRFAEAVRRLMISTDQALRRVRGDDLSDAASIIMVTSANAGEGKTTAAVSLARSYAISGQSTILIDADLRR
                                            TSANAGEGKTTAAVSLARSYAISGQSTILIDADLRR
                                                   GKT                 ILIDADLR 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PAVHKELGLEPSDALADYLASAGTPGDDIAPLMLTDGLSKAKFIIGSNIRGAAAGQVVSGERFAKLLNSASRLFDVVIVD
PAVHKELGLEPSDALADYLASAGTPGDDIAPLMLTDGLSKAKFIIGSNIRGAAAGQVVSGERFAKLLNSASRLFDVVIVD
                                                                            VIVD
       650       660       670       680       690       700       710      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
TPPVGALVDALYLAQHVDVIVNVVRFGITSQKEVRATLRELVEAKQDNAEVVALLNAEPQSQAETRRRFGSYYVQA
TPPVGALVDALYLAQHVDVIVNVVRFGITSQKEVRATLRELVEAKQDNAEVVALLNAEPQSQAETRRRFGSYYVQA
TPP                                                                    YY   

© 1998-2019