BYKdb

Annotate results for A0A085EUB3

A0A085EUB3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A085EUB3
DOMAINtad19/200GLLDVDRLFSILRRQFRVLLLCLGLGLMLAVIYLMLAPKTYVASSQILLDKNLKESVSDI
APSTSAVDLESEVLNQIEVMRSSRIAAAVAEAENLMTDREFLNPPPSFTRRIRGMILGLL
SPILGAPEADPDDMQASVEQAAGALRANMFVERVGRSAVIRVGYEASSPELAQRIAAAYA
NV
DOMAINcd567/754VSVLPGEGKTTYSVALAEMLATDGERVLLIDADLRQAASSRLVAPGATSGLMDIGGTVSW
RDVVLADPRSGLHILPALSTSGQSSDFLSSDGMHGLLEEARQSYDYVIIDLPPLGPVMDA
RAVLPWTDGFILVTEWGRTPRRLVRSLIEHEPELAEDIVGVVLNKVDFRKLAQYSDPGGA
ERYMGSYS
SITEWalker A574/576GKT
SITEWalker A'594/601LLIDADLR
SITEWalker B673/679VIIDLPP
SITE-670/-672YDY
SITEY Cluster749/757YMGSYSRYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLERSQLPAMSDPHSSDRGLLDVDRLFSILRRQFRVLLLCLGLGLMLAVIYLMLAPKTYVASSQILLDKNLKESVSDIAP
                  GLLDVDRLFSILRRQFRVLLLCLGLGLMLAVIYLMLAPKTYVASSQILLDKNLKESVSDIAP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STSAVDLESEVLNQIEVMRSSRIAAAVAEAENLMTDREFLNPPPSFTRRIRGMILGLLSPILGAPEADPDDMQASVEQAA
STSAVDLESEVLNQIEVMRSSRIAAAVAEAENLMTDREFLNPPPSFTRRIRGMILGLLSPILGAPEADPDDMQASVEQAA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GALRANMFVERVGRSAVIRVGYEASSPELAQRIAAAYANVFVQDQLNADIDATRQAADWLQQRLTELGDNQRQATLAVEE
GALRANMFVERVGRSAVIRVGYEASSPELAQRIAAAYANV                                        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YRRQSGLSTSENENLSNQRLEALTAQLVTAQAESARVNALAVQLQATIDAGPSAAGASIALLSGSGVDDKTISDLRIRYA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIQSRINEVSATYGEDHPQVSALKAENQALQAQIFAQLQGLNEQYQSQLTIAQRQESSLREAIETEGQLASQTNQAQVEL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TELQQRSTTLGVIYNSFLSRYEEAVQRQSFPIPSARIITTAQAPENASGPRTLFVAAGGTIFGLFLGLMFGTFNELRERT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FRIGDQVGNELGLRFLGYLPRLGPDARGASHGDQTKAALALHGMIKKQVEERRANRPTTAFVETLKSAKLVMRARGKPDR


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAVIGVVSVLPGEGKTTYSVALAEMLATDGERVLLIDADLRQAASSRLVAPGATSGLMDIGGTVSWRDVVLADPRSGLHI
      VSVLPGEGKTTYSVALAEMLATDGERVLLIDADLRQAASSRLVAPGATSGLMDIGGTVSWRDVVLADPRSGLHI
             GKT                 LLIDADLR                                       
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LPALSTSGQSSDFLSSDGMHGLLEEARQSYDYVIIDLPPLGPVMDARAVLPWTDGFILVTEWGRTPRRLVRSLIEHEPEL
LPALSTSGQSSDFLSSDGMHGLLEEARQSYDYVIIDLPPLGPVMDARAVLPWTDGFILVTEWGRTPRRLVRSLIEHEPEL
                                VIIDLPP                                         
       730       740       750       760     
....:....|....:....|....:....|....:....|....:
AEDIVGVVLNKVDFRKLAQYSDPGGAERYMGSYSRYYQVDATEKV
AEDIVGVVLNKVDFRKLAQYSDPGGAERYMGSYS           
                            YMGSYSRYY        

© 1998-2019