BYKdb

Annotate results for A0A086D8I5

A0A086D8I5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A086D8I5
DOMAINtad25/276EEIDIRRLFGILVDHKKWVLASVAAFAMLGLIYVSVATPIYRADALVQIESSSPGSNPLK
EVSTLLGQEPPTLSEIEIIQSRMVLGRAVDLLNLDISVAPVTLPVIGGLLERQHVSRPGF
AAGWHYAFSGESIAVSEMPVADAYEGQPFRLQVLDSYRYRLFDADGNDLGEGKLGELSNF
ADGGVALRVTSIDAGAGATFELRHGSRLAAINALRGRLTVAEAGSETGILSWSLTGPDPQ
ETEKTLNTIANI
DOMAINcd560/745TGPSPGVGKSFVSVNLAAVCAQAGQRVLVIDADMRKGQVHSVFGATSESGLSDVLGGRLT
LDEAIRDVDECEGLHYVARGMAPPNPSELLMGSRFSAFLAAASERFDLVIVDSPPVLAVT
DAAIIGKQVGTSLMLVRFERNPVKELELAIARLRTAGVEPRGAILNAVERKAATAYGYGY
YHYNYQ
SITEWalker A567/569GKS
SITEWalker A'587/594LVIDADMR
SITEWalker B668/674VIVDSPP
SITEY Cluster735/744YGYGYYHYNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTHASNAQSGTQTSTPSASAPRSHEEIDIRRLFGILVDHKKWVLASVAAFAMLGLIYVSVATPIYRADALVQIESSSPGS
                        EEIDIRRLFGILVDHKKWVLASVAAFAMLGLIYVSVATPIYRADALVQIESSSPGS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NPLKEVSTLLGQEPPTLSEIEIIQSRMVLGRAVDLLNLDISVAPVTLPVIGGLLERQHVSRPGFAAGWHYAFSGESIAVS
NPLKEVSTLLGQEPPTLSEIEIIQSRMVLGRAVDLLNLDISVAPVTLPVIGGLLERQHVSRPGFAAGWHYAFSGESIAVS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EMPVADAYEGQPFRLQVLDSYRYRLFDADGNDLGEGKLGELSNFADGGVALRVTSIDAGAGATFELRHGSRLAAINALRG
EMPVADAYEGQPFRLQVLDSYRYRLFDADGNDLGEGKLGELSNFADGGVALRVTSIDAGAGATFELRHGSRLAAINALRG

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLTVAEAGSETGILSWSLTGPDPQETEKTLNTIANIYYSQNVQRQSEEARKSLEFLDGQVPKIRAQVDRAEEKLNRYRES
RLTVAEAGSETGILSWSLTGPDPQETEKTLNTIANI                                            

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QDSVDLSLETKSVLDRLVNLEAQLNELEMNEAEIAQRFTKSHPTYQALLEKKAQLQRERANLDKQIKAMPKTQQEILRLK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDAEVNNEIYVQLLNKVQETRIAEASTVGNVRVLDSAQVLATPVAPNKPLLLAVAVIVGLIVGVAGVFLRALFHRGIETQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EQIEETGLAVYATVPLSDEQRKLNRREQRGRRGTRRDPRYPQGLLSLRNPADVTVEALRGLRTSLHFAMLEASDNRLMIT
                                                                               T

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GPSPGVGKSFVSVNLAAVCAQAGQRVLVIDADMRKGQVHSVFGATSESGLSDVLGGRLTLDEAIRDVDECEGLHYVARGM
GPSPGVGKSFVSVNLAAVCAQAGQRVLVIDADMRKGQVHSVFGATSESGLSDVLGGRLTLDEAIRDVDECEGLHYVARGM
      GKS                 LVIDADMR                                              
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
APPNPSELLMGSRFSAFLAAASERFDLVIVDSPPVLAVTDAAIIGKQVGTSLMLVRFERNPVKELELAIARLRTAGVEPR
APPNPSELLMGSRFSAFLAAASERFDLVIVDSPPVLAVTDAAIIGKQVGTSLMLVRFERNPVKELELAIARLRTAGVEPR
                           VIVDSPP                                              
       730       740     
....:....|....:....|....:
GAILNAVERKAATAYGYGYYHYNYQ
GAILNAVERKAATAYGYGYYHYNYQ
              YGYGYYHYNY 

© 1998-2019