BYKdb

Annotate results for A0A086DVG5

A0A086DVG5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A086DVG5
DOMAINtad1/135MELRDYIRILRKSWVLIVLLTLVAVGAASTYSILQTPTFSATAKVFVSTQSTGTTSELAQ
GNSFTVQRVKTYSDLVATPIVLLPVIGSLDLGITPDALATKVTASAPLDTSIIDITVTDT
DPVRAAETANAISAS
DOMAINcd268/455TSSIEAEGKSTTGANLAIALADSGSRVLLVDADLRRPKIADYMGIEGAVGLTDVLIGKAE
LKDVIQPWGRAQLFVLPAGHIPPNPSELLGSARMTHIIGELNRAFDVVLFDSPPLLPVTD
AAVLAKNVGGALIIVAAGRTHKNQLKGAIAALTNVGTSVSGLVLTMLPTKGPDAYGYGNY
GYGYGSDL
SITEWalker A275/277GKS
SITEWalker A'295/302LLVDADLR
SITEWalker B375/381VLFDSPP
SITEY Cluster442/451YGYGNYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELRDYIRILRKSWVLIVLLTLVAVGAASTYSILQTPTFSATAKVFVSTQSTGTTSELAQGNSFTVQRVKTYSDLVATPI
MELRDYIRILRKSWVLIVLLTLVAVGAASTYSILQTPTFSATAKVFVSTQSTGTTSELAQGNSFTVQRVKTYSDLVATPI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLLPVIGSLDLGITPDALATKVTASAPLDTSIIDITVTDTDPVRAAETANAISASLTSVVAEIETPVGADAVSPVKLTRA
VLLPVIGSLDLGITPDALATKVTASAPLDTSIIDITVTDTDPVRAAETANAISAS                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQATVPSIPVSPNVPLNIALGALVGLALGVGIAVLRETLETRIRNQRDVEQVTDSPILGGIVFDPKAQERPLIVHVDPRS


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRAESFRTLRTNLQFLDVGRTERAFVVTSSIEAEGKSTTGANLAIALADSGSRVLLVDADLRRPKIADYMGIEGAVGLTD
                           TSSIEAEGKSTTGANLAIALADSGSRVLLVDADLRRPKIADYMGIEGAVGLTD
                                  GKS                 LLVDADLR                  
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLIGKAELKDVIQPWGRAQLFVLPAGHIPPNPSELLGSARMTHIIGELNRAFDVVLFDSPPLLPVTDAAVLAKNVGGALI
VLIGKAELKDVIQPWGRAQLFVLPAGHIPPNPSELLGSARMTHIIGELNRAFDVVLFDSPPLLPVTDAAVLAKNVGGALI
                                                      VLFDSPP                   
       410       420       430       440       450       460       470      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
IVAAGRTHKNQLKGAIAALTNVGTSVSGLVLTMLPTKGPDAYGYGNYGYGYGSDLDAETAAAPKGKAGPRRTRVQA
IVAAGRTHKNQLKGAIAALTNVGTSVSGLVLTMLPTKGPDAYGYGNYGYGYGSDL                     
                                         YGYGNYGYGY                         
© 1998-2019