BYKdb

Annotate results for A0A086DVZ0

A0A086DVZ0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A086DVZ0
DOMAINtad1/135MELRDYIRILRKSWVLILLLTLVAVAGASVFSIVQTPKYSATSKVFVSTQSSGTTSELAQ
GNSFTVQRVKTYSDLVVTPIVLLPVIGKLELGITSDQLASRVTASAPLDTSIIDITVTDT
DPVRAAATANAISVS
DOMAINcd268/455TSSVESEGKSTTGANLAIALADAGARVLLVDADLRRPKIAEYMGVEGAVGLTDVLIGRAA
LKDAIQPWGKGQLFVLPAGHVPPNPSELLGSARMSLLIAELNSSFDVVLFDTPPLLPVTD
AAILAKNVGGVILIIAAGRTHKNQLRGAISALDNVGAPISGLVLTMLPTKGPDAYGYGHY
GYGYGYGY
SITEWalker A275/277GKS
SITEWalker A'295/302LLVDADLR
SITEWalker B375/381VLFDTPP
SITEY Cluster442/455YGYGHYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELRDYIRILRKSWVLILLLTLVAVAGASVFSIVQTPKYSATSKVFVSTQSSGTTSELAQGNSFTVQRVKTYSDLVVTPI
MELRDYIRILRKSWVLILLLTLVAVAGASVFSIVQTPKYSATSKVFVSTQSSGTTSELAQGNSFTVQRVKTYSDLVVTPI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLLPVIGKLELGITSDQLASRVTASAPLDTSIIDITVTDTDPVRAAATANAISVSLTAVVQNIETPDQAGAVSPVKLTRA
VLLPVIGKLELGITSDQLASRVTASAPLDTSIIDITVTDTDPVRAAATANAISVS                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QEATVPSVPVSPNVPLNIALGALVGLALGVAIAVLRETLETRIRNERDVEQITAVPILGGIVFDSKAQERPLIVHVDPRS


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRAESFRTLRTNLQFLDVGRADRAFVVTSSVESEGKSTTGANLAIALADAGARVLLVDADLRRPKIAEYMGVEGAVGLTD
                           TSSVESEGKSTTGANLAIALADAGARVLLVDADLRRPKIAEYMGVEGAVGLTD
                                  GKS                 LLVDADLR                  
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLIGRAALKDAIQPWGKGQLFVLPAGHVPPNPSELLGSARMSLLIAELNSSFDVVLFDTPPLLPVTDAAILAKNVGGVIL
VLIGRAALKDAIQPWGKGQLFVLPAGHVPPNPSELLGSARMSLLIAELNSSFDVVLFDTPPLLPVTDAAILAKNVGGVIL
                                                      VLFDTPP                   
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IIAAGRTHKNQLRGAISALDNVGAPISGLVLTMLPTKGPDAYGYGHYGYGYGYGYGEETGAETSPSSAPASARPPVARRT
IIAAGRTHKNQLRGAISALDNVGAPISGLVLTMLPTKGPDAYGYGHYGYGYGYGY                         
                                         YGYGHYGYGYGYGY                         
    
....
NLRK


© 1998-2019