BYKdb

Annotate results for A0A086W7H9

A0A086W7H9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A086W7H9
DOMAINtad36/294TTVDLKGYFNTLYDSRWLIGSITAFITVVAVLYALVAKPVYEANLMIHVEEESPNASKNI
LSEASSLFETKKAAIAEMELLRSRMVVSRAVDNLQLYIEVQPKYFPVAGFWFANQNAGNL
STPGLFGYGGYVWGGEKADVSVFEVPDSWLNREFVLTARAGNRYRFSGGGQRLAFDGTVG
QRYRVPLPDGMLEIKVDNLYANPGARFRIKRKSRLSTIQDIQRAMVITEQGKQSGVIEVK
LQGENSARINNLLSEIGRE
DOMAINcd571/758AGPTRDLGKSFIAANFAAVMAASGKRVLLIDADMRNGHLHRYFGVDRGKGLSRAIAGGAT
VDEVIHRNVLDRLDFIPTGELPTNRAEFLLHLNFGTLLETVSPQYDLVLIDPPPLLAVAD
ALIIGAHAGAVFLVTRSAVTTEGQINESIKRLNHAGISPRGVLFNDMALRLGDYRSQYGG
GPQLAYVA
SITEWalker A578/580GKS
SITEWalker A'598/605LLIDADMR
SITEWalker B678/684VLIDPPP
SITEY Cluster744/748YRSQY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSNPADAHPLTHISHSPPVLSVPFDPRPPEPLPEETTVDLKGYFNTLYDSRWLIGSITAFITVVAVLYALVAKPVYEANL
                                   TTVDLKGYFNTLYDSRWLIGSITAFITVVAVLYALVAKPVYEANL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIHVEEESPNASKNILSEASSLFETKKAAIAEMELLRSRMVVSRAVDNLQLYIEVQPKYFPVAGFWFANQNAGNLSTPGL
MIHVEEESPNASKNILSEASSLFETKKAAIAEMELLRSRMVVSRAVDNLQLYIEVQPKYFPVAGFWFANQNAGNLSTPGL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FGYGGYVWGGEKADVSVFEVPDSWLNREFVLTARAGNRYRFSGGGQRLAFDGTVGQRYRVPLPDGMLEIKVDNLYANPGA
FGYGGYVWGGEKADVSVFEVPDSWLNREFVLTARAGNRYRFSGGGQRLAFDGTVGQRYRVPLPDGMLEIKVDNLYANPGA

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RFRIKRKSRLSTIQDIQRAMVITEQGKQSGVIEVKLQGENSARINNLLSEIGREYMRQNLARKTEEAEKSLAFLNQQLPI
RFRIKRKSRLSTIQDIQRAMVITEQGKQSGVIEVKLQGENSARINNLLSEIGRE                          

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LKRQLEQSEDRYNQFRNAHGTVDLREEARMSLAQAAAARTRRMELIQKKTELLSRFTEDHPVVVAINRQRKEVDTEIEAI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASRIRTLPVMEQDEARLTRDIKVNTDLYTALSNTAQQLRLISVGRVSNVRLVDAPIAPEKPIKPNRPLIVAMAVVTGLFL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTLIAFTRKAMRGGIDDPQKIERMLRARVVYASIPHSTNQDKLMRKSKPNGVLPLLAQILPEDPAVESLRSFRAALQFSM


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PHFKSNVVMMAGPTRDLGKSFIAANFAAVMAASGKRVLLIDADMRNGHLHRYFGVDRGKGLSRAIAGGATVDEVIHRNVL
          AGPTRDLGKSFIAANFAAVMAASGKRVLLIDADMRNGHLHRYFGVDRGKGLSRAIAGGATVDEVIHRNVL
                 GKS                 LLIDADMR                                   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DRLDFIPTGELPTNRAEFLLHLNFGTLLETVSPQYDLVLIDPPPLLAVADALIIGAHAGAVFLVTRSAVTTEGQINESIK
DRLDFIPTGELPTNRAEFLLHLNFGTLLETVSPQYDLVLIDPPPLLAVADALIIGAHAGAVFLVTRSAVTTEGQINESIK
                                     VLIDPPP                                    
       730       740       750        
....:....|....:....|....:....|....:...
RLNHAGISPRGVLFNDMALRLGDYRSQYGGGPQLAYVA
RLNHAGISPRGVLFNDMALRLGDYRSQYGGGPQLAYVA
                       YRSQY          

© 1998-2019