BYKdb

Annotate results for A0A086ZSZ1

A0A086ZSZ1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A086ZSZ1
DOMAINtad23/163GGVTLMDMLRIIRKHLISAIITFVVVFAAVCAYTLLVPPKYSATAQAFATYNQTVANSED
ISSVNNASSYISNQIKSYPTLTTTEAVLQPVIDDLGLNVTVAQLGQQLTVTNPTNTAFVN
ITVEDDSPQQSATIANEVAKS
DOMAINcd296/485SSVSPNEGKTTTSVNIAATLAENGASVLLIDADLRHPSVADKLSLEGNAGLAHVLSGQAS
VKDVVQRYWKPNLHIMPAGPKPPNASALLNSKTMKELIRQALTQYDYVIIDTSPMIVAND
AAVFGAMGGGIVLVSGRDVTDKRELRDIASQLDNLGVTVTGFVFNFAKETKKTSSYGNYY
YDDDDSTQHR
SITEWalker A303/305GKT
SITEWalker A'323/330LLIDADLR
SITEWalker B403/409VIIDTSP
SITE-400/-402YDY
SITEY Cluster471/476YGNYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVAEKSEPIQGQAPVEAVEQRDGGVTLMDMLRIIRKHLISAIITFVVVFAAVCAYTLLVPPKYSATAQAFATYNQTVANS
                      GGVTLMDMLRIIRKHLISAIITFVVVFAAVCAYTLLVPPKYSATAQAFATYNQTVANS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EDISSVNNASSYISNQIKSYPTLTTTEAVLQPVIDDLGLNVTVAQLGQQLTVTNPTNTAFVNITVEDDSPQQSATIANEV
EDISSVNNASSYISNQIKSYPTLTTTEAVLQPVIDDLGLNVTVAQLGQQLTVTNPTNTAFVNITVEDDSPQQSATIANEV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKSLQSVVQNSLYDSSQKSPVKLTIVQQATEPTSPSSPKVALNMAIGLVVGAILAVFVALIRDLLSTKVQESHDLQEIID
AKS                                                                             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
APIMGRIPDDESLKQPVPVIVSAPSSSIAEEYRRVRTNLSFTSPVEGSNARLIVISSVSPNEGKTTTSVNIAATLAENGA
                                                       SSVSPNEGKTTTSVNIAATLAENGA
                                                              GKT               
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVLLIDADLRHPSVADKLSLEGNAGLAHVLSGQASVKDVVQRYWKPNLHIMPAGPKPPNASALLNSKTMKELIRQALTQY
SVLLIDADLRHPSVADKLSLEGNAGLAHVLSGQASVKDVVQRYWKPNLHIMPAGPKPPNASALLNSKTMKELIRQALTQY
  LLIDADLR                                                                      
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DYVIIDTSPMIVANDAAVFGAMGGGIVLVSGRDVTDKRELRDIASQLDNLGVTVTGFVFNFAKETKKTSSYGNYYYDDDD
DYVIIDTSPMIVANDAAVFGAMGGGIVLVSGRDVTDKRELRDIASQLDNLGVTVTGFVFNFAKETKKTSSYGNYYYDDDD
  VIIDTSP                                                             YGNYYY    
       490      
....:....|....:.
STQHRKGKRRSSSKKK
STQHR           

© 1998-2019