BYKdb

Annotate results for A0A086ZYI3

A0A086ZYI3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A086ZYI3
DOMAINtad1/145MTIADILQTLKKHLAAELVVLLVVLAGGFVYVSRQTPQYTATAQMFASFNHNVSSGDSKD
TPTPGFTQIQSESDYVTSMLGTLPTLVTTPAVLDPVIDQLKLDTTATALASRITIGTSSS
YFVNIAVNDTDAQRAADIANAVGES
DOMAINcd281/468TSSGANEGKTTIAVNLAAALAENGAKVLLIDTDLRKPSVAKHLGLDGTVGLSHLLTGQVS
SSEAIQQYWKPNLHILPAGEQTTNPSILINSNAMKTLLDKVSGLYDHIIVDTTPLRVAND
AAVFAKDGARMLLVASQGVTIKRQLRDAVQELAMIDVTVVGSVFNQMQARKGGDDYYYYY
SYSGKGKG
SITEWalker A288/290GKT
SITEWalker A'308/315LLIDTDLR
SITEWalker B388/394IIVDTTP
SITEY Cluster456/462YYYYYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTIADILQTLKKHLAAELVVLLVVLAGGFVYVSRQTPQYTATAQMFASFNHNVSSGDSKDTPTPGFTQIQSESDYVTSML
MTIADILQTLKKHLAAELVVLLVVLAGGFVYVSRQTPQYTATAQMFASFNHNVSSGDSKDTPTPGFTQIQSESDYVTSML

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTLPTLVTTPAVLDPVIDQLKLDTTATALASRITIGTSSSYFVNIAVNDTDAQRAADIANAVGESLKTQLSDDSYSSEKT
GTLPTLVTTPAVLDPVIDQLKLDTTATALASRITIGTSSSYFVNIAVNDTDAQRAADIANAVGES               

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YVLSYLNLSVVKEAVAPGAPSSPNVKSFMFKMALIALVAAACVGMAIDVLDNRLRQMADLQRIADAPVLGTVMKDPEFRA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DKPVVVANPSGSASESIRRLALNLAFISPDRTNRSNVIVITSSGANEGKTTIAVNLAAALAENGAKVLLIDTDLRKPSVA
                                        TSSGANEGKTTIAVNLAAALAENGAKVLLIDTDLRKPSVA
                                               GKT                 LLIDTDLR     
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KHLGLDGTVGLSHLLTGQVSSSEAIQQYWKPNLHILPAGEQTTNPSILINSNAMKTLLDKVSGLYDHIIVDTTPLRVAND
KHLGLDGTVGLSHLLTGQVSSSEAIQQYWKPNLHILPAGEQTTNPSILINSNAMKTLLDKVSGLYDHIIVDTTPLRVAND
                                                                   IIVDTTP      
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAVFAKDGARMLLVASQGVTIKRQLRDAVQELAMIDVTVVGSVFNQMQARKGGDDYYYYYSYSGKGKGHKGLELPSFGKD
AAVFAKDGARMLLVASQGVTIKRQLRDAVQELAMIDVTVVGSVFNQMQARKGGDDYYYYYSYSGKGKG            
                                                       YYYYYSY                  
  
..
KS


© 1998-2019