BYKdb

Annotate results for A0A087A7B6

A0A087A7B6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A087A7B6
DOMAINtad10/152DGLTVMDLLMAVRKHLITAIVTLVIVVAAVAGYTFTRTPQYTATSELLATYRTSASSNNG
GAGSELNSGANYLTSQIQTYPQLVKTESVLQPVIDDLGLNTTVTELAKTVTASNPTDTML
VDISVQNDNPKDASNIANAVAKS
DOMAINcd287/475TSAGPAEGKTTTSVNLATAFAENGSKVLLIDADVRNPSVSKKLDIEGTVGLTHLITNRVS
SQDAIQRYWKPNFHVLPAGKQNLNPSILLNSRAMKALIVQVAGAYDYVIIDTAPMQVAND
AAVFAKDGPELLLVAGVGVTEKKQLKQTEQELETLNIKAAGVAMNYVEAEKPQKSGYYYY
GDDADGKGK
SITEWalker A294/296GKT
SITEWalker A'314/321LLIDADVR
SITEWalker B394/400VIIDTAP
SITE-391/-393YDY
SITEY Cluster463/466YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNEPEEGQQDGLTVMDLLMAVRKHLITAIVTLVIVVAAVAGYTFTRTPQYTATSELLATYRTSASSNNGGAGSELNSGAN
         DGLTVMDLLMAVRKHLITAIVTLVIVVAAVAGYTFTRTPQYTATSELLATYRTSASSNNGGAGSELNSGAN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YLTSQIQTYPQLVKTESVLQPVIDDLGLNTTVTELAKTVTASNPTDTMLVDISVQNDNPKDASNIANAVAKSLKEQVTST
YLTSQIQTYPQLVKTESVLQPVIDDLGLNTTVTELAKTVTASNPTDTMLVDISVQNDNPKDASNIANAVAKS        

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LYSDEGDKIVSPVNLTVVQQAYAPASPSSPNIKLYLAVGVFGGLILGIVAALIKDLMDTRVRQDSDVTAIVDAPVLGGLT


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RNDAYDDKAPVIIAHPASREAEEVRRLRTNVAFVLPDEKFSNVIVVTSAGPAEGKTTTSVNLATAFAENGSKVLLIDADV
                                              TSAGPAEGKTTTSVNLATAFAENGSKVLLIDADV
                                                     GKT                 LLIDADV
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RNPSVSKKLDIEGTVGLTHLITNRVSSQDAIQRYWKPNFHVLPAGKQNLNPSILLNSRAMKALIVQVAGAYDYVIIDTAP
RNPSVSKKLDIEGTVGLTHLITNRVSSQDAIQRYWKPNFHVLPAGKQNLNPSILLNSRAMKALIVQVAGAYDYVIIDTAP
R                                                                        VIIDTAP
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQVANDAAVFAKDGPELLLVAGVGVTEKKQLKQTEQELETLNIKAAGVAMNYVEAEKPQKSGYYYYGDDADGKGKKSQHG
MQVANDAAVFAKDGPELLLVAGVGVTEKKQLKQTEQELETLNIKAAGVAMNYVEAEKPQKSGYYYYGDDADGKGK     
                                                              YYYY              
       490     
....:....|....:
SAKSDAQTKADDKNS


© 1998-2019